DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRP19 and Srp19

DIOPT Version :9

Sequence 1:NP_003126.1 Gene:SRP19 / 6728 HGNCID:11300 Length:144 Species:Homo sapiens
Sequence 2:NP_477135.2 Gene:Srp19 / 38815 FlyBaseID:FBgn0015298 Length:160 Species:Drosophila melanogaster


Alignment Length:150 Identity:73/150 - (48%)
Similarity:98/150 - (65%) Gaps:15/150 - (10%)


- Green bases have known domain annotations that are detailed below.


Human     8 SPA----DQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMY 68
            ||:    |.:|:|||||||:|.|||..||||:|....|:||:..||:||.|...|. ||.:||.|
  Fly    12 SPSMKHNDMERWICIYPAYINRKKTRQEGRRLPKENCVDNPSYIEIRDVLSVSNLQ-FLMENKKY 75

Human    69 SREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGA--DQSLQQ 131
            .||.:.::::||||||||:..||:|....||:|:|:||:.|..||:||||..|:|.:  .||..|
  Fly    76 CRENSSEMEFRGRVRVQLRNVDGTLYNNDFPTRESIMLHIASKIPQLKTRQNKSGDSYHQQSQPQ 140

Human   132 --------GEGSKKGKGKKK 143
                    |.|.||||||::
  Fly   141 SNASGSGGGGGGKKGKGKRR 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRP19NP_003126.1 SRP19 17..115 CDD:396484 51/97 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..144 15/36 (42%)
Basic region, potentially involved in RNA-binding 136..144 6/7 (86%)
Srp19NP_477135.2 SRP19 25..122 CDD:280156 51/97 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154215
Domainoid 1 1.000 102 1.000 Domainoid score I6865
eggNOG 1 0.900 - - E1_COG1400
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2361
Inparanoid 1 1.050 130 1.000 Inparanoid score I4654
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55727
OrthoDB 1 1.010 - - D1552706at2759
OrthoFinder 1 1.000 - - FOG0003563
OrthoInspector 1 1.000 - - oto88949
orthoMCL 1 0.900 - - OOG6_101284
Panther 1 1.100 - - LDO PTHR17453
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4771
SonicParanoid 1 1.000 - - X3986
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.