DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRMS and PIN3

DIOPT Version :9

Sequence 1:NP_543013.1 Gene:SRMS / 6725 HGNCID:11298 Length:488 Species:Homo sapiens
Sequence 2:NP_015480.1 Gene:PIN3 / 856277 SGDID:S000006358 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:272 Identity:60/272 - (22%)
Similarity:87/272 - (31%) Gaps:100/272 - (36%)


- Green bases have known domain annotations that are detailed below.


Human     5 LRRRLAFL-------SFFWDKI-------WPAGGEPDHGTPGSLDPNTDPVPTLPAEPCSPFPQL 55
            :|..|.||       :..:|:|       |.....|.:.:|.||                   :.
Yeast    13 IRTELDFLKGSNVISNDVYDQINKSLPAKWDPANAPRNASPASL-------------------EY 58

Human    56 FLALYDFTARCGGELSVRRGDRLCALEEGGGYIFARRLSGQPSAGLVPITHVAKA-----SPETL 115
            ..|||.|..:..|:|.::.||::..||:.....:....:|:  .|:.|..:|..|     .|..|
Yeast    59 VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGR--TGIFPANYVKPAFSGSNGPSNL 121

Human   116 SDQPWYFSGVSRTQAQQLLLSPPNEPGAFLIRPSESSLGGYSLSVRAQAKVCHYRVSMAADGSLY 180
            ...|.|       :||:|...|.....|                                  |.|
Yeast   122 PPPPQY-------KAQELQQIPTQNSAA----------------------------------SSY 145

Human   181 LQKGRLFPGLEELLTYYKANWKLIQNPLLQPCM---PQKAPRQDVWERPHSEF-ALGRKLGE-GY 240
            .|:.  ||  .....||       |.|..||..   ||:..:|...:..||.. :.|.|||. ..
Yeast   146 QQQP--FP--PPSTNYY-------QQPQQQPQQAPPPQQQQQQQQHQSSHSHLKSFGSKLGNAAI 199

Human   241 FGEVWEGLWLGS 252
            ||   .|..:||
Yeast   200 FG---AGASIGS 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRMSNP_543013.1 SH3_Srms 55..109 CDD:212780 14/53 (26%)
SH2 119..197 CDD:301589 12/77 (16%)
PTKc_Srm_Brk 223..483 CDD:133248 11/32 (34%)
STYKc 232..480 CDD:214568 9/22 (41%)
PIN3NP_015480.1 SH3 58..110 CDD:418401 14/53 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.