Sequence 1: | NP_543013.1 | Gene: | SRMS / 6725 | HGNCID: | 11298 | Length: | 488 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_011652.1 | Gene: | LSB1 / 853037 | SGDID: | S000003368 | Length: | 241 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 210 | Identity: | 55/210 - (26%) |
---|---|---|---|
Similarity: | 76/210 - (36%) | Gaps: | 50/210 - (23%) |
- Green bases have known domain annotations that are detailed below.
Human 58 ALYDFTARCGGELSVRRGDRLCALEEGGGYIFARRLSGQPSAGLVPITHVAKASPETLSDQPWYF 122
Human 123 SGVSRTQAQQLLLSPPN-EPGAFLIRPSESSL-----GGYSLSVRAQAKVCHYRVSMAADGSLYL 181
Human 182 QKGRLFPGLEELLTYYKANWKLIQNPLLQPCMP-QKAPRQDVWERPH------SEF-ALGRKLGE 238
Human 239 -GYFGEVWEGLWLGS 252 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
SRMS | NP_543013.1 | SH3_Srms | 55..109 | CDD:212780 | 17/50 (34%) |
SH2 | 119..197 | CDD:301589 | 13/83 (16%) | ||
PTKc_Srm_Brk | 223..483 | CDD:133248 | 12/38 (32%) | ||
STYKc | 232..480 | CDD:214568 | 9/22 (41%) | ||
LSB1 | NP_011652.1 | SH3 | 55..108 | CDD:214620 | 16/49 (33%) |
PRK14971 | <100..>156 | CDD:237874 | 14/57 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000006 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |