DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRMS and LSB1

DIOPT Version :9

Sequence 1:NP_543013.1 Gene:SRMS / 6725 HGNCID:11298 Length:488 Species:Homo sapiens
Sequence 2:NP_011652.1 Gene:LSB1 / 853037 SGDID:S000003368 Length:241 Species:Saccharomyces cerevisiae


Alignment Length:210 Identity:55/210 - (26%)
Similarity:76/210 - (36%) Gaps:50/210 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    58 ALYDFTARCGGELSVRRGDRLCALEEGGGYIFARRLSGQPSAGLVPITHVAKASPETLSDQPWYF 122
            |||||.|:..|:||::.||::..||:.....:  |.......|:.|..:|..|.  |.|..|...
Yeast    60 ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWY--RGKSNNKIGIFPANYVKPAF--TRSASPKSA 120

Human   123 SGVSRTQAQQLLLSPPN-EPGAFLIRPSESSL-----GGYSLSVRAQAKVCHYRVSMAADGSLYL 181
            ...|.:...:..:.||: ||.|......:.|.     .||..:...|                  
Yeast   121 EAASSSTVSRPSVPPPSYEPAASQYPSQQVSAPYAPPAGYMQAPPPQ------------------ 167

Human   182 QKGRLFPGLEELLTYYKANWKLIQNPLLQPCMP-QKAPRQDVWERPH------SEF-ALGRKLGE 238
            |:....|.......||       |.|..|...| |:||   |..:|.      |.| :.|.|||.
Yeast   168 QQQAPLPYPPPFTNYY-------QQPQQQYAPPSQQAP---VEAQPQQSSGASSAFKSFGSKLGN 222

Human   239 -GYFGEVWEGLWLGS 252
             ..||   .|..:||
Yeast   223 AAIFG---AGSAIGS 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRMSNP_543013.1 SH3_Srms 55..109 CDD:212780 17/50 (34%)
SH2 119..197 CDD:301589 13/83 (16%)
PTKc_Srm_Brk 223..483 CDD:133248 12/38 (32%)
STYKc 232..480 CDD:214568 9/22 (41%)
LSB1NP_011652.1 SH3 55..108 CDD:214620 16/49 (33%)
PRK14971 <100..>156 CDD:237874 14/57 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.