DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cinp and CG34174

DIOPT Version :9

Sequence 1:NP_081499.1 Gene:Cinp / 67236 MGIID:1914486 Length:262 Species:Mus musculus
Sequence 2:NP_001097057.1 Gene:CG34174 / 5740699 FlyBaseID:FBgn0085203 Length:217 Species:Drosophila melanogaster


Alignment Length:233 Identity:43/233 - (18%)
Similarity:80/233 - (34%) Gaps:78/233 - (33%)


- Green bases have known domain annotations that are detailed below.


Mouse    13 KPVLSVSARKLKDNAADWHNLILKWDSLSDKGFTTASSIANLKVSLLSKEKVELESSSPASMEEE 77
            |..|....::|:||.|       ||.....:|.:...:|...|...|.|             .::
  Fly    45 KTRLETIVKQLQDNYA-------KWQLAHQRGTSICYTIEAKKTKCLEK-------------SQD 89

Mouse    78 EKTNLDYDKGLEALCEELQAILDGLMSKKAQAHRGAIRVRSAGAVVPVPLSNSSPLGFRRLFGAK 142
            |.::| |...|...|.:|..|..                                     :||  
  Fly    90 EGSSL-YPDDLLLPCNKLAIIAS-------------------------------------IFG-- 114

Mouse   143 ALLLHRKLTETKIQMKMEKLSSTTKGICELENYHYREESSRPPLFH-TWPTAFFYEVSRRLSEAY 206
                       .|....:::....:||.:|..      |:...:|: :|....|...::.|||.|
  Fly   115 -----------DIANNTKEILRQLRGILKLPG------SAADTIFYRSWKLQQFVVFAKELSERY 162

Mouse   207 KKELLLKHTIGAELAHTADRNLSLTYLSMWLHQPYIES 244
            :||.|:|..:...:||:.:|:..:.:.::|....:::|
  Fly   163 EKEALVKMEVAGNIAHSTERSQLIAHTTLWEFPEHVDS 200



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849733
Domainoid 1 1.000 46 1.000 Domainoid score I12031
eggNOG 1 0.900 - - E1_2CXWD
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I5482
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009694
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.750

Return to query results.
Submit another query.