DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BRCA1 and CG44271

DIOPT Version :9

Sequence 1:NP_009231.2 Gene:BRCA1 / 672 HGNCID:1100 Length:1884 Species:Homo sapiens
Sequence 2:NP_001285689.1 Gene:CG44271 / 19835868 FlyBaseID:FBgn0265257 Length:106 Species:Drosophila melanogaster


Alignment Length:46 Identity:25/46 - (54%)
Similarity:29/46 - (63%) Gaps:3/46 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    24 CPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDIT 69
            ||||:.|...||:|.|.|||||.|:...|||.   ..||||||.:|
  Fly    57 CPICMSLPDHPVATTCGHIFCKECLTTALNQL---HYCPLCKNFVT 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BRCA1NP_009231.2 RING 23..68 CDD:238093 24/43 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..270
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..338
BRCT_assoc 345..507 CDD:289581
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 534..570
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 654..709
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1181..1216
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1322..1387
Interaction with PALB2. /evidence=ECO:0000269|PubMed:19369211 1397..1424
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1586..1617
BRCT 1671..1745 CDD:237994
BRCT 1779..1863 CDD:214602
CG44271NP_001285689.1 RING 57..95 CDD:238093 21/40 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42023
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.