DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRD5A2 and Srd5a2

DIOPT Version :9

Sequence 1:NP_000339.2 Gene:SRD5A2 / 6716 HGNCID:11285 Length:254 Species:Homo sapiens
Sequence 2:NP_444418.1 Gene:Srd5a2 / 94224 MGIID:2150380 Length:254 Species:Mus musculus


Alignment Length:254 Identity:191/254 - (75%)
Similarity:215/254 - (84%) Gaps:0/254 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPA 65
            |.:.|.|.|||||||||..:|.|.|...||:.||||:||:......||||.||||||||||.|..
Mouse     1 MPIVCHQVPVLAGSATLATMGTLILCFGKPASYGKHSESVSSGVPLLPARIAWFLQELPSFVVSV 65

Human    66 GILARQPLSLFGPPGTVLLGLFCLHYFHRTFVYSLLNRGRPYPAILILRGTAFCTGNGVLQGYYL 130
            |:||.||.|||||||.||||||..|||||||:||||.||||..|::.|:.||||.|||:||.|||
Mouse    66 GMLAWQPRSLFGPPGNVLLGLFSAHYFHRTFIYSLLTRGRPLSAVIFLKATAFCIGNGLLQAYYL 130

Human   131 IYCAEYPDGWYTDIRFSLGVFLFILGMGINIHSDYILRQLRKPGEISYRIPQGGLFTYVSGANFL 195
            :||||||:.||||:|||:|||.||||||||||||.:|||||||||:.||||||||||||||||||
Mouse   131 VYCAEYPEEWYTDMRFSVGVFFFILGMGINIHSDCMLRQLRKPGEVIYRIPQGGLFTYVSGANFL 195

Human   196 GEIIEWIGYALATWSLPALAFAFFSLCFLGLRAFHHHRFYLKMFEDYPKSRKALIPFIF 254
            ||||||:||||||||:||.|||||:|||||::||:|||||||||:||||||||||||||
Mouse   196 GEIIEWMGYALATWSVPAFAFAFFTLCFLGMQAFYHHRFYLKMFKDYPKSRKALIPFIF 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRD5A2NP_000339.2 Steroid_dh 105..254 CDD:251363 120/148 (81%)
Srd5a2NP_444418.1 Steroid_dh 105..254 CDD:251363 120/148 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83954843
Domainoid 1 1.000 269 1.000 Domainoid score I18388
eggNOG 1 0.900 - - E1_KOG1638
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37292
Inparanoid 1 1.050 411 1.000 Inparanoid score I13527
Isobase 00.000 Not matched by this tool.
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG62721
OrthoDB 1 1.010 - - D1574389at2759
OrthoFinder 1 1.000 - - FOG0001983
OrthoInspector 1 1.000 - - oto124380
orthoMCL 1 0.900 - - OOG6_102555
Panther 1 1.100 - - LDO PTHR10556
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1836
SonicParanoid 1 1.000 - - X1297
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1717.340

Return to query results.
Submit another query.