DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRD5A2 and TSC13

DIOPT Version :9

Sequence 1:NP_000339.2 Gene:SRD5A2 / 6716 HGNCID:11285 Length:254 Species:Homo sapiens
Sequence 2:NP_010269.1 Gene:TSC13 / 851547 SGDID:S000002173 Length:310 Species:Saccharomyces cerevisiae


Alignment Length:181 Identity:43/181 - (23%)
Similarity:68/181 - (37%) Gaps:37/181 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    83 LLGLF--CLHYFHRTFVYSLLNRGRPYPAILILRGTAFCTGNGVLQGYYLIYCAEYPDGWYTDIR 145
            :..||  |.||:   .:..|::.|        ..|..|..||..|..||.....:       |:.
Yeast   158 IFNLFKNCFHYW---VLSGLISFG--------YFGYGFPFGNAKLFKYYSYLKLD-------DLS 204

Human   146 FSLGVFL------FILGMGINIHSDYILRQLRKPGEISYRIP-QGGLFTYVSGANFLGEIIEWIG 203
            ..:|:|:      |...:.:.:..||    .:|.|....|:| ..|:|......|:..|:..|| 
Yeast   205 TLIGLFVLSELWNFYCHIKLRLWGDY----QKKHGNAKIRVPLNQGIFNLFVAPNYTFEVWSWI- 264

Human   204 YALATWSLPALAFAFFSLCFLGLRAFHHHRFYLKMFEDYPKSRKALIPFIF 254
                 |......|..|::.||.:.....:.:..|..:.|...|..||||:|
Yeast   265 -----WFTFVFKFNLFAVLFLTVSTAQMYAWAQKKNKKYHTRRAFLIPFVF 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRD5A2NP_000339.2 Steroid_dh 105..254 CDD:251363 35/155 (23%)
TSC13NP_010269.1 PLN02560 1..297 CDD:178174 36/166 (22%)
Steroid_dh 154..310 CDD:251363 42/179 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C159047282
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.