DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRC and LSB1

DIOPT Version :9

Sequence 1:XP_016883513.1 Gene:SRC / 6714 HGNCID:11283 Length:542 Species:Homo sapiens
Sequence 2:NP_011652.1 Gene:LSB1 / 853037 SGDID:S000003368 Length:241 Species:Saccharomyces cerevisiae


Alignment Length:76 Identity:25/76 - (32%)
Similarity:39/76 - (51%) Gaps:14/76 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    75 SPQRAGPLAGGVTTFV-ALYDYESRTETDLSFKKGERLQIVNNTRKVDVREGDWWLAHSLSTGQT 138
            |||.|     ....:| ||||:|::.:.|||.|.|:::|::...      ..||:  ...|..:.
Yeast    48 SPQNA-----DTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKI------SPDWY--RGKSNNKI 99

Human   139 GYIPSNYVAPS 149
            |..|:|||.|:
Yeast   100 GIFPANYVKPA 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRCXP_016883513.1 SH3_Src 88..149 CDD:212941 20/61 (33%)
SH2_Src_Src 153..253 CDD:198228
PTKc_Src 266..542 CDD:270656
LSB1NP_011652.1 SH3 55..108 CDD:214620 19/60 (32%)
PRK14971 <100..>156 CDD:237874 6/11 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.