DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRC and LSB1

DIOPT Version :10

Sequence 1:XP_047296363.1 Gene:SRC / 6714 HGNCID:11283 Length:562 Species:Homo sapiens
Sequence 2:NP_011652.1 Gene:LSB1 / 853037 SGDID:S000003368 Length:241 Species:Saccharomyces cerevisiae


Alignment Length:70 Identity:25/70 - (35%)
Similarity:39/70 - (55%) Gaps:8/70 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   101 SPQRAGPLAGGVTTFV-ALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSN 164
            |||.|     ....:| ||||:|::.:.|||.|.|:::|::.....||:  ...|..:.|..|:|
Yeast    48 SPQNA-----DTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWY--RGKSNNKIGIFPAN 105

Human   165 YVAPS 169
            ||.|:
Yeast   106 YVKPA 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRCXP_047296363.1 SH3_Src 114..169 CDD:212941 20/55 (36%)
SH2_Src_Src 173..273 CDD:198228
PTKc_Src 286..562 CDD:270656
LSB1NP_011652.1 SH3 55..108 CDD:214620 19/54 (35%)
PRK12323 <100..>156 CDD:481241 6/11 (55%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.