DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRC and skb5

DIOPT Version :9

Sequence 1:XP_016883513.1 Gene:SRC / 6714 HGNCID:11283 Length:542 Species:Homo sapiens
Sequence 2:NP_588016.1 Gene:skb5 / 2539237 PomBaseID:SPCC24B10.13 Length:140 Species:Schizosaccharomyces pombe


Alignment Length:145 Identity:30/145 - (20%)
Similarity:52/145 - (35%) Gaps:59/145 - (40%)


- Green bases have known domain annotations that are detailed below.


Human     2 GSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGG 66
            ||:.|:..|.::.....|.:|:.|                        |||:|...|        
pombe    51 GSDDSESIDDTEVFYDAEESESTH------------------------PSASFNVLA-------- 83

Human    67 FNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTRKVDVREGDWWLAH 131
                                 ..|||||:|...:.:|.|..|:||.|::.:      ...|.:|:
pombe    84 ---------------------DAVALYDFEPLHDNELGFTTGQRLCILSES------SDGWLIAY 121

Human   132 SLSTGQTGYIPSNYV 146
            ..::|::|.:|..:|
pombe   122 DDASGRSGLVPETFV 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRCXP_016883513.1 SH3_Src 88..149 CDD:212941 18/59 (31%)
SH2_Src_Src 153..253 CDD:198228
PTKc_Src 266..542 CDD:270656
skb5NP_588016.1 SH3_Nbp2-like 84..138 CDD:212799 18/59 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 42 1.000 Domainoid score I4126
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.