DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbd4 and anox

DIOPT Version :10

Sequence 1:NP_080264.1 Gene:Acbd4 / 67131 MGIID:1914381 Length:329 Species:Mus musculus
Sequence 2:NP_001027085.1 Gene:anox / 3771728 FlyBaseID:FBgn0064116 Length:243 Species:Drosophila melanogaster


Alignment Length:80 Identity:29/80 - (36%)
Similarity:40/80 - (50%) Gaps:12/80 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse    36 EMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNRLGKMSREEAMSAYISEMKLVAQK---- 96
            ::|.||.||||||.|||....||......:.||.||..||.||:..|..||:.:::.:...    
  Fly    31 DLLIFYGYYKQATNGPCKEQSPGLLQLQAKSKWQAWRNLGTMSQSAARQAYVQKLQELQPNWRSR 95

Mouse    97 --------VIDTVPL 103
                    .|::|||
  Fly    96 RNPGWVVHSIESVPL 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbd4NP_080264.1 ACBP 11..95 CDD:469667 25/58 (43%)
anoxNP_001027085.1 ACBP 10..85 CDD:459982 25/53 (47%)
ANKYR <121..>231 CDD:440430
ANK repeat 148..179 CDD:293786
ANK repeat 181..212 CDD:293786
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.