DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT1 and CG17380

DIOPT Version :10

Sequence 1:NP_857593.1 Gene:SPINT1 / 6692 HGNCID:11246 Length:529 Species:Homo sapiens
Sequence 2:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster


Alignment Length:62 Identity:23/62 - (37%)
Similarity:33/62 - (53%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   242 STKQTEDYCLASNKVGRCRGSFPRWYYDPTEQICKSFVYGGCLGNKNNYLREEECILACRGV 303
            ||....:.|......|.|:|:|..:.||....:|..|:||||.||.|.:..::||||.|..:
  Fly    17 STALRHERCSFIANPGPCKGNFEMFAYDMDNNVCVEFIYGGCGGNPNRFQTKKECILLCNAL 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT1NP_857593.1 MANEC 50..139 CDD:462186
Kunitz_HAI1_1-like 245..303 CDD:438666 21/57 (37%)
LDLa 334..366 CDD:197566
Kunitz_HAI1_2-like 390..450 CDD:438667
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 20/49 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.