DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT1 and CG34276

DIOPT Version :10

Sequence 1:NP_857593.1 Gene:SPINT1 / 6692 HGNCID:11246 Length:529 Species:Homo sapiens
Sequence 2:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster


Alignment Length:56 Identity:20/56 - (35%)
Similarity:28/56 - (50%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   386 SDKGHCVDLPDTGLCKESIPRWYYNPFSEHCARFTYGGCYGNKNNFEEEQQCLESC 441
            |.|..|:...|.|..|..:..|:||..|:.|.||.:.|...|.|||..:.:|.:.|
  Fly    21 SIKRRCLQPLDVGKGKAYLRNWFYNSTSQRCQRFIFYGGASNGNNFNTQARCHKIC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT1NP_857593.1 MANEC 50..139 CDD:462186
Kunitz_HAI1_1-like 245..303 CDD:438666
LDLa 334..366 CDD:197566
Kunitz_HAI1_2-like 390..450 CDD:438667 18/52 (35%)
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 17/49 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.