DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT1 and CG13748

DIOPT Version :9

Sequence 1:NP_001373802.1 Gene:SPINT1 / 6692 HGNCID:11246 Length:529 Species:Homo sapiens
Sequence 2:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster


Alignment Length:73 Identity:29/73 - (39%)
Similarity:42/73 - (57%) Gaps:4/73 - (5%)


- Green bases have known domain annotations that are detailed below.


Human   231 EDTANVTVTVLSTKQTEDYCLASNKVGRCRGSFPRWYYDPTEQICKSFVYGGCLGNKNNYLREEE 295
            :|.||   |..:| ..|.:||...:.|.||...|||.|||.::.|..|.:|||.||:||:...::
  Fly    45 DDVAN---TGRNT-HPEQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKD 105

Human   296 CILACRGV 303
            |:..|.|:
  Fly   106 CMSTCEGM 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT1NP_001373802.1 MANEC 50..139 CDD:400058
Kunitz_BPTI 249..301 CDD:394972 21/51 (41%)
LDLa 334..366 CDD:197566
Kunitz_BPTI 391..442 CDD:394972
CG13748NP_610430.1 Kunitz_BPTI 59..110 CDD:278443 21/50 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7117
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.