powered by:
Protein Alignment SPINT1 and CG13748
DIOPT Version :9
Sequence 1: | NP_001373802.1 |
Gene: | SPINT1 / 6692 |
HGNCID: | 11246 |
Length: | 529 |
Species: | Homo sapiens |
Sequence 2: | NP_610430.1 |
Gene: | CG13748 / 35896 |
FlyBaseID: | FBgn0033355 |
Length: | 113 |
Species: | Drosophila melanogaster |
Alignment Length: | 73 |
Identity: | 29/73 - (39%) |
Similarity: | 42/73 - (57%) |
Gaps: | 4/73 - (5%) |
- Green bases have known domain annotations that are detailed below.
Human 231 EDTANVTVTVLSTKQTEDYCLASNKVGRCRGSFPRWYYDPTEQICKSFVYGGCLGNKNNYLREEE 295
:|.|| |..:| ..|.:||...:.|.||...|||.|||.::.|..|.:|||.||:||:...::
Fly 45 DDVAN---TGRNT-HPEQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKD 105
Human 296 CILACRGV 303
|:..|.|:
Fly 106 CMSTCEGM 113
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S7117 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.760 |
|
Return to query results.
Submit another query.