DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT1 and CG2816

DIOPT Version :10

Sequence 1:NP_857593.1 Gene:SPINT1 / 6692 HGNCID:11246 Length:529 Species:Homo sapiens
Sequence 2:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster


Alignment Length:54 Identity:21/54 - (38%)
Similarity:30/54 - (55%) Gaps:0/54 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   250 CLASNKVGRCRGSFPRWYYDPTEQICKSFVYGGCLGNKNNYLREEECILACRGV 303
            ||.....|||.|....:.|:|.::.|:.|:||||.||.|.:..:.||...||.:
  Fly    31 CLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFSTKAECEFNCRDI 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT1NP_857593.1 MANEC 50..139 CDD:462186
Kunitz_HAI1_1-like 245..303 CDD:438666 21/52 (40%)
LDLa 334..366 CDD:197566
Kunitz_HAI1_2-like 390..450 CDD:438667
CG2816NP_608803.2 Kunitz_SCI-I-like 30..81 CDD:438677 19/49 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.