DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT1 and CG10031

DIOPT Version :10

Sequence 1:NP_857593.1 Gene:SPINT1 / 6692 HGNCID:11246 Length:529 Species:Homo sapiens
Sequence 2:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster


Alignment Length:68 Identity:30/68 - (44%)
Similarity:38/68 - (55%) Gaps:5/68 - (7%)


- Green bases have known domain annotations that are detailed below.


Human   380 QRIHFPSDKGHCVDLPDTGLCKESIPRWYYNPFSEHCARFTYGGCYGNKNNFEEEQQCLESCRGI 444
            ||: .|..|  |:...|.|.|:.|:.|:|||..|:.|..|.||||.||.|.:...|.|.|:|  |
  Fly    67 QRL-VPDPK--CLQPLDVGPCRMSLERFYYNKDSKACETFKYGGCRGNDNRWGFRQTCEEAC--I 126

Human   445 SKK 447
            .||
  Fly   127 PKK 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT1NP_857593.1 MANEC 50..139 CDD:462186
Kunitz_HAI1_1-like 245..303 CDD:438666
LDLa 334..366 CDD:197566
Kunitz_HAI1_2-like 390..450 CDD:438667 26/58 (45%)
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 22/49 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.