DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT1 and CG16704

DIOPT Version :10

Sequence 1:NP_857593.1 Gene:SPINT1 / 6692 HGNCID:11246 Length:529 Species:Homo sapiens
Sequence 2:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster


Alignment Length:45 Identity:18/45 - (40%)
Similarity:25/45 - (55%) Gaps:0/45 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   398 GLCKESIPRWYYNPFSEHCARFTYGGCYGNKNNFEEEQQCLESCR 442
            |.|:...|.|.|.|.:..|..|.|.||:||.|.|.::.:|.|.|:
  Fly    34 GTCRSLQPMWTYRPDTNECFTFNYSGCHGNNNLFHKKLECEEKCK 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT1NP_857593.1 MANEC 50..139 CDD:462186
Kunitz_HAI1_1-like 245..303 CDD:438666
LDLa 334..366 CDD:197566
Kunitz_HAI1_2-like 390..450 CDD:438667 18/45 (40%)
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 17/42 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.