DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT1 and CG31515

DIOPT Version :10

Sequence 1:NP_857593.1 Gene:SPINT1 / 6692 HGNCID:11246 Length:529 Species:Homo sapiens
Sequence 2:NP_732865.2 Gene:CG31515 / 326147 FlyBaseID:FBgn0051515 Length:129 Species:Drosophila melanogaster


Alignment Length:66 Identity:23/66 - (34%)
Similarity:35/66 - (53%) Gaps:6/66 - (9%)


- Green bases have known domain annotations that are detailed below.


Human   391 CVDLPDTGLCKESIPRWYYNPFSEHCARFTYGGCYGNKNNFEEEQQCLESC------RGISKKDV 449
            |:.:|..|.||:.|..:.||..:..|:.|||.||.||.|.|..:.||..:|      :.:|:.|.
  Fly    47 CLFIPSYGRCKKHIAVYGYNIITNRCSEFTYSGCGGNPNRFMTDSQCRNTCYVVPARKTVSEPDY 111

Human   450 F 450
            :
  Fly   112 Y 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT1NP_857593.1 MANEC 50..139 CDD:462186
Kunitz_HAI1_1-like 245..303 CDD:438666
LDLa 334..366 CDD:197566
Kunitz_HAI1_2-like 390..450 CDD:438667 23/64 (36%)
CG31515NP_732865.2 Kunitz-type 47..97 CDD:438633 20/49 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.