DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT1 and CG31609

DIOPT Version :10

Sequence 1:NP_857593.1 Gene:SPINT1 / 6692 HGNCID:11246 Length:529 Species:Homo sapiens
Sequence 2:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster


Alignment Length:52 Identity:19/52 - (36%)
Similarity:30/52 - (57%) Gaps:0/52 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   391 CVDLPDTGLCKESIPRWYYNPFSEHCARFTYGGCYGNKNNFEEEQQCLESCR 442
            |..:.:.|.|.:.:..|.|:..:..|..|.||||.||.|.|..:::||::||
  Fly    31 CWYVANPGPCDDFVKVWGYDYLTNRCIFFYYGGCGGNPNRFYTKEECLKTCR 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT1NP_857593.1 MANEC 50..139 CDD:462186
Kunitz_HAI1_1-like 245..303 CDD:438666
LDLa 334..366 CDD:197566
Kunitz_HAI1_2-like 390..450 CDD:438667 19/52 (37%)
CG31609NP_723444.2 Kunitz-type 31..81 CDD:444694 17/49 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.