DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT1 and CG43165

DIOPT Version :10

Sequence 1:NP_857593.1 Gene:SPINT1 / 6692 HGNCID:11246 Length:529 Species:Homo sapiens
Sequence 2:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster


Alignment Length:73 Identity:23/73 - (31%)
Similarity:34/73 - (46%) Gaps:11/73 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   240 VLSTKQTEDYCLA-----------SNKVGRCRGSFPRWYYDPTEQICKSFVYGGCLGNKNNYLRE 293
            :|...:|...||.           .|...:|.|||.::.|.|...:|:.|.||||.||.|::...
  Fly     9 LLLALETVGLCLKDPICGQPPAVNGNDFIKCAGSFEKFSYYPHINVCQKFEYGGCFGNDNSFNTL 73

Human   294 EECILACR 301
            |:|...|:
  Fly    74 EKCHKKCK 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT1NP_857593.1 MANEC 50..139 CDD:462186
Kunitz_HAI1_1-like 245..303 CDD:438666 22/68 (32%)
LDLa 334..366 CDD:197566
Kunitz_HAI1_2-like 390..450 CDD:438667
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 18/55 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.