DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT1 and CG42828

DIOPT Version :10

Sequence 1:NP_857593.1 Gene:SPINT1 / 6692 HGNCID:11246 Length:529 Species:Homo sapiens
Sequence 2:NP_001189271.1 Gene:CG42828 / 10178934 FlyBaseID:FBgn0262010 Length:89 Species:Drosophila melanogaster


Alignment Length:66 Identity:22/66 - (33%)
Similarity:34/66 - (51%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   239 TVLSTKQTEDYCLASNKVGRCRGSFPRWYYDPTEQICKSFVYGGCLGNKNNYLREEECILACRGV 303
            ||.|.::.:.:|....:.|:|.|....|.:...||.|..||:..|.||:|.:..:|.|..||..:
  Fly    17 TVESAEKRKAFCYLPYEFGKCGGHRIMWAFSNKEQECVPFVFSNCGGNENRFYTKENCEKACATI 81

Human   304 Q 304
            |
  Fly    82 Q 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT1NP_857593.1 MANEC 50..139 CDD:462186
Kunitz_HAI1_1-like 245..303 CDD:438666 18/57 (32%)
LDLa 334..366 CDD:197566
Kunitz_HAI1_2-like 390..450 CDD:438667
CG42828NP_001189271.1 KU 27..78 CDD:197529 16/50 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.