DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lztr1 and rdx

DIOPT Version :9

Sequence 1:NP_080084.2 Gene:Lztr1 / 66863 MGIID:1914113 Length:837 Species:Mus musculus
Sequence 2:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster


Alignment Length:472 Identity:116/472 - (24%)
Similarity:181/472 - (38%) Gaps:131/472 - (27%)


- Green bases have known domain annotations that are detailed below.


Mouse   226 CNFPVAVCRDKMFVFSGQSG--AKITNNLFQFEFKDKTWTRIPTEHLLRGSPPPPQ------RRY 282
            ||.....|..::.|...|:.  |::|:|| .........:|:|       |||.|:      ..:
  Fly   421 CNAAANFCDKRLPVNECQASQTARVTSNL-HASSSTMAVSRVP-------SPPLPEVNTPVAENW 477

Mouse   283 GHTMVAFDRHLYVFGGAADNTLPNELHCYDVDFQTWEVVQPSSDSEVGGAEM-------PERA-S 339
            .:|.|...:..|::      |:.|...|.:   :..||::.|:.|.....::       |:.. .
  Fly   478 CYTQVKVVKFSYMW------TINNFSFCRE---EMGEVLKSSTFSAGANDKLKWCLRVNPKGLDE 533

Mouse   340 SSEDASTL--------TSEERSSFKKS------------------RDVFGLDFGTTSAKQPVHLA 378
            .|:|..:|        .||.|:.||.|                  |.|.|.|:|.....:...|.
  Fly   534 ESKDYLSLYLLLVSCNKSEVRAKFKFSILNAKREETKAMESQRAYRFVQGKDWGFKKFIRRDFLL 598

Mouse   379 SE----LPSGRL--FHAAAVISDAMYIFGGTVDNNIRSGEMYRFQFSCYPKCTLHEDYGRLWEGR 437
            .|    ||..:|  |...:|::|::.|          ||:....||. .|:|.|.||.|.|::..
  Fly   599 DEANGLLPEDKLTIFCEVSVVADSVNI----------SGQSNIVQFK-VPECKLSEDLGNLFDNE 652

Mouse   438 QFCDVEFVLGEKEECVQGHVAIVTARSRWLRRKIVQAQEWLAQKLEEDGALAPKEAPGPAVGRAR 502
            :|.||...:|.:|  .|.|.||:.|||     .:..|.  ...::||                  
  Fly   653 KFSDVTLSVGGRE--FQAHKAILAARS-----DVFAAM--FEHEMEE------------------ 690

Mouse   503 PPLLRVAIREAEARPFEVLMQFLYTDKIKYPRKGHVEDVLLIMDVYKLALSFQLCRLEQLCRQYI 567
            ..|.||||.:.:....:.:::|:||.|.....| ..:|:|...|.|.|.....:|. |.||   :
  Fly   691 RKLNRVAITDVDHEVLKEMLRFIYTGKAPNLEK-MADDLLAAADKYALEKLKVMCE-EALC---V 750

Mouse   568 EASVDLQNVLVVCESAARLQL-------GQLKEHCLNFIVKESHFNQVIMMKEFERL---SSPLI 622
            ..||         |:||...:       .|||...::||  .:|...|:....::.:   .|.||
  Fly   751 NLSV---------ETAAETLILADLHSADQLKAQTIDFI--NTHATDVMETSGWQNMITTHSHLI 804

Mouse   623 VEIVR--RKQQPPPRTP 637
            .|..|  ..||.||..|
  Fly   805 AEAFRALATQQIPPIGP 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lztr1NP_080084.2 KELCH repeat 65..111 CDD:276965
Kelch_3 74..123 CDD:290151
Kelch 1. /evidence=ECO:0000255 76..125
KELCH repeat 115..169 CDD:276965
Kelch_3 124..180 CDD:290151
Kelch 2. /evidence=ECO:0000255 127..182
Kelch_4 171..217 CDD:290154
Kelch 3. /evidence=ECO:0000255 184..235 3/8 (38%)
Kelch_3 234..289 CDD:290151 14/62 (23%)
Kelch 4. /evidence=ECO:0000255 236..282 12/53 (23%)
Kelch_1 280..323 CDD:279660 8/42 (19%)
KELCH repeat 281..323 CDD:276965 8/41 (20%)
Kelch 5. /evidence=ECO:0000255 292..338 9/52 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..352 8/43 (19%)
Kelch 6. /evidence=ECO:0000255 396..447 15/50 (30%)
SPOP_C_like 571..631 CDD:269810 16/71 (23%)
BTB 662..761 CDD:279045
BTB 665..762 CDD:197585
SPOP_C_like 765..>804 CDD:269810
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 30/146 (21%)
BTB 645..749 CDD:279045 34/132 (26%)
BTB 656..752 CDD:197585 33/127 (26%)
SPOP_C 752..814 CDD:269807 17/72 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.