DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex10 and Topors

DIOPT Version :9

Sequence 1:NP_001035866.1 Gene:Pex10 / 668173 MGIID:2684988 Length:324 Species:Mus musculus
Sequence 2:NP_001261083.1 Gene:Topors / 37188 FlyBaseID:FBgn0267351 Length:1038 Species:Drosophila melanogaster


Alignment Length:45 Identity:20/45 - (44%)
Similarity:26/45 - (57%) Gaps:1/45 - (2%)


- Green bases have known domain annotations that are detailed below.


Mouse   269 PLCTLCLEE-RRHSTATPCGHLFCWECITEWCNTKTECPLCREKF 312
            |.|.:||.. ||......|.|.||::|:.||...|.|||||::.|
  Fly   100 PNCAICLSRCRRKCFTDSCMHQFCFKCLCEWSKIKPECPLCKQPF 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex10NP_001035866.1 Pex2_Pex12 16..215 CDD:282595
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..139
zf-RING_2 271..309 CDD:290367 17/38 (45%)
ToporsNP_001261083.1 RING 102..144 CDD:238093 18/41 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23350
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.