DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPAG1 and CG1847

DIOPT Version :9

Sequence 1:XP_016869243.1 Gene:SPAG1 / 6674 HGNCID:11212 Length:961 Species:Homo sapiens
Sequence 2:NP_001368980.1 Gene:CG1847 / 32144 FlyBaseID:FBgn0030345 Length:390 Species:Drosophila melanogaster


Alignment Length:339 Identity:71/339 - (20%)
Similarity:126/339 - (37%) Gaps:90/339 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    89 YPELT-----EFCEKHLQA-------LAPESRALRKDKPAATAASFTAEEWEKIDGDIKSWVSEI 141
            |.|||     :|   |.|.       :..:||.:.|.........|..|.||.|           
  Fly    23 YIELTPGTRVKF---HFQTRRAGDSRIIDDSRKMEKPMELVLGKKFKLEVWELI----------- 73

Human   142 KKEEDKMHFHETETFPAMKD---NLPPVRGSNSCLHVGKEKYSKR----PTKKKTPRDYAEWD-- 197
               ..:|..:|...|...|.   ..|.:  |.:...:||:...:|    .|.:.....|.:.|  
  Fly    74 ---VQQMSLNEVAKFTVHKSLCAQYPFI--SKTLRDIGKKPEERRHCCGMTLQNEGIGYTDLDEL 133

Human   198 -------KFDVEKECLKIDEDYKEKTVIDKSHLSKIETRIDTAGLTEKEKDFLATREKEKGNEAF 255
                   :|.:|...:::.|.|::    ::..:|..|..:.|:.|            :|:||..:
  Fly   134 LQNPSDLEFIIELFSIELPEQYEK----ERWQMSDDEKMLATSTL------------RERGNNFY 182

Human   256 NSGDYEEAVMYYTRSI--------------------SALPTVVAYNNRAQAEIKLQNWNSAFQDC 300
            .:..:.||...|..::                    :|:.|.:.. |.||..:...::.:..:.|
  Fly   183 KASRFTEAETCYREAVGIVEQLMLKEKPHDEEWQELAAIKTPLLL-NYAQCRLIAGDFYAVIEHC 246

Human   301 EKVLELEPGNVKALLRRATTYKHQNKLREATEDLSKVLDVEPDNDLAKKTLSEVERDLKNSEAAS 365
            .:||.|:|.|||||.|||..:.......:|..|....|.:    |.:.|  |.|.::||:.|...
  Fly   247 NEVLTLDPRNVKALFRRAKAHAGAWNPAQARRDFLDALAL----DASLK--STVSKELKSIEDQQ 305

Human   366 ETQTKGKRMVIQEI 379
            :.:....|:.:|::
  Fly   306 QARNVQDRIHMQKL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPAG1XP_016869243.1 None
CG1847NP_001368980.1 FKBP_C 23..>92 CDD:395196 19/85 (22%)
3a0801s09 150..>308 CDD:273380 40/180 (22%)
TPR repeat 173..217 CDD:276809 7/55 (13%)
TPR repeat 222..252 CDD:276809 7/30 (23%)
TPR repeat 257..285 CDD:276809 9/27 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1535
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.