DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP2 and odd

DIOPT Version :9

Sequence 1:XP_011523438.1 Gene:SP2 / 6668 HGNCID:11207 Length:771 Species:Homo sapiens
Sequence 2:NP_722922.1 Gene:odd / 33583 FlyBaseID:FBgn0002985 Length:392 Species:Drosophila melanogaster


Alignment Length:462 Identity:110/462 - (23%)
Similarity:151/462 - (32%) Gaps:151/462 - (32%)


- Green bases have known domain annotations that are detailed below.


Human   326 ASDTGAPTQLLTESPPTPLSKTN----------KKARKKSL-PASQPPVAVAEQVETVLIETTAD 379
            :|.:.:|...:|......||:..          |:.|:.|| |...||....|:.          
  Fly     2 SSTSASPISNITVDDELNLSREQDFAEEDFIVIKEERETSLSPMLTPPHTPTEEP---------- 56

Human   380 NIIQAGNNLLIVQSPGGGQPAVVQQVQVVPPKAEQQQVVQIPQQALRVVQAASATLPTVPQKPSQ 444
                     |....|...:.||..|:.:......|||..|..||     |.....|    |...|
  Fly    57 ---------LRRVHPAISEEAVATQLHMRHMAHYQQQQQQQQQQ-----QQHRLWL----QMQQQ 103

Human   445 NFQIQAAEPTPTQVYIRTPSGEVQTVLVQDSPPATAAATSNTTCSSPA--------SRAPHLSGT 501
            ..|.||.:..|  ||   |:.....|.|...       ..|....:.|        .:.||    
  Fly   104 QQQHQAPQQYP--VY---PTASADPVAVHQQ-------LMNHWIRNAAIYQQQQQQQQHPH---- 152

Human   502 SKKHSAAILRKERPLP---KIAPAGSIISLNAAQLAAAAQAMQTININGV-QVQGVPVTITNTGG 562
             ..|.........|.|   :..||| :.||:||.:.....||.|:.:.|. ...|||        
  Fly   153 -HHHHHGHPHHPHPHPHHVRPYPAG-LHSLHAAVMGRHFGAMPTLKLGGAGGASGVP-------- 207

Human   563 QQQLTVQNVSGNNLTISGLSPTQIQLQMEQALAGETQPGEKRRRMACTCPNCKDGEKRSGEQGKK 627
                            ||.:             |.::|                         ||
  Fly   208 ----------------SGAT-------------GSSRP-------------------------KK 218

Human   628 KHVCHIPDCGKTFRKTSLLRAHVRLHTGERPFVCNWFFCGKRFTRSDELQRHARTHTGDKRFECA 692
            :.:|..  |.:.|.|:..|..|.|.||.|||:.|:  .|||.|.|.|.|:.|...|:.||.|:|:
  Fly   219 QFICKY--CNRQFTKSYNLLIHERTHTDERPYSCD--ICGKAFRRQDHLRDHRYIHSKDKPFKCS 279

Human   693 QCQKRFMRSDHLTKHYKTHL---------VTKNFCLRQNLQLGSSASFVFSLGELGEGTPEEGAV 748
            .|.|.|.:|..|..|..|||         ..::|..|.||:     |.:.|..|  :.|.|....
  Fly   280 DCGKGFCQSRTLAVHKVTHLEEGPHKCPICQRSFNQRANLK-----SHLQSHSE--QSTKEVVVT 337

Human   749 VSQSDPH 755
            .|.:..|
  Fly   338 TSPATSH 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SP2XP_011523438.1 COG5048 <553..718 CDD:227381 43/173 (25%)
zf-C2H2 629..653 CDD:278523 7/23 (30%)
C2H2 Zn finger 634..653 CDD:275368 6/18 (33%)
zf-H2C2_2 646..672 CDD:290200 13/25 (52%)
C2H2 Zn finger 661..683 CDD:275368 9/21 (43%)
zf-H2C2_2 675..698 CDD:290200 9/22 (41%)
zf-C2H2 689..711 CDD:278523 8/21 (38%)
C2H2 Zn finger 691..711 CDD:275368 7/19 (37%)
oddNP_722922.1 COG5048 <203..334 CDD:227381 52/203 (26%)
C2H2 Zn finger 222..242 CDD:275368 7/21 (33%)
zf-H2C2_2 234..259 CDD:290200 13/26 (50%)
C2H2 Zn finger 250..270 CDD:275368 9/21 (43%)
zf-H2C2_2 262..285 CDD:290200 9/22 (41%)
C2H2 Zn finger 278..298 CDD:275368 7/19 (37%)
zf-C2H2 304..326 CDD:278523 5/26 (19%)
C2H2 Zn finger 306..326 CDD:275368 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.