DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP1 and btd

DIOPT Version :9

Sequence 1:NP_612482.2 Gene:SP1 / 6667 HGNCID:11205 Length:785 Species:Homo sapiens
Sequence 2:NP_511100.1 Gene:btd / 31912 FlyBaseID:FBgn0000233 Length:644 Species:Drosophila melanogaster


Alignment Length:383 Identity:138/383 - (36%)
Similarity:189/383 - (49%) Gaps:63/383 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   369 NIQQNQTSGGSLQAGQQKEGEQNQQTQQQQ--------ILIQPQLVQGGQALQALQAAPLSG--- 422
            ::.|.|......|..||::.:|.||.||||        :|..|..:.|..:..:..::||.|   
  Fly    60 HLTQQQQQQQQQQQQQQQQQQQQQQPQQQQHDFLSAAALLSAPPSLSGSSSGSSSGSSPLYGKPP 124

Human   423 ---QTFTTQAISQETLQ-NLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTIT 483
               :....||.|..|.. |..:|:.|:|..:   :|::.|:...|:.::.      .:|...|.|
  Fly   125 MKLELPYPQASSTGTASPNSSIQSAPSSASV---SPSIFPSPAQSFASIS------ASPSTPTTT 180

Human   484 LAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQ--------LSSMPGLQTINLSALGTS 540
            |||....:.|..:.|.|:.:|.:||||..|......||.        .|:..|..|. .|.||.:
  Fly   181 LAPPTTAAAGALAGSPTSSSPSSSAASAAAAAAAAAAAAADLGAAAVASAAYGWNTA-YSGLGPA 244

Human   541 GIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDD------TAGGEEGENSPDA--QPQAGR 597
            ..|      .|.| ..|...:|..:|:..:.....|.:      ::....|.|..|.  |.|..|
  Fly   245 RSQ------FPYA-QYASDYYGNAVGMSSSAAWFSHQERLYQPWSSQSYPGFNFDDIAFQTQLQR 302

Human   598 RTRREACTCPYCKDSEGRGSG-------DPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERP 655
            |:.|  ||||.|.:..   ||       |...:|||||||.||.::|||.|||:.||||||||||
  Fly   303 RSVR--CTCPNCTNEM---SGLPPIVGPDERGRKQHICHIPGCERLYGKASHLKTHLRWHTGERP 362

Human   656 FMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTH-QNKK 712
            |:|.  .|||||:||||||||.||||..:.:|||.|.|:|.||||||||.||| ::||
  Fly   363 FLCL--TCGKRFSRSDELQRHGRTHTNYRPYACPICSKKFSRSDHLSKHKKTHFKDKK 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SP1NP_612482.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..93
Repressor domain 2..82
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..141
Transactivation domain A (Gln-rich) 146..251
Transactivation domain B (Gln-rich) 261..495 36/140 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 329..395 8/25 (32%)
9aaTAD. /evidence=ECO:0000269|PubMed:31375868 462..470 1/7 (14%)
Transactivation domain C (highly charged) 496..610 35/129 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 567..598 6/38 (16%)
VZV IE62-binding 619..785 64/95 (67%)
C2H2 Zn finger 628..650 CDD:275368 14/21 (67%)
zf-H2C2_2 642..669 CDD:290200 19/26 (73%)
C2H2 Zn finger 658..680 CDD:275368 15/21 (71%)
zf-H2C2_2 672..695 CDD:290200 14/22 (64%)
zf-C2H2 686..708 CDD:278523 15/21 (71%)
C2H2 Zn finger 688..708 CDD:275368 14/19 (74%)
Domain D 708..785 3/6 (50%)
btdNP_511100.1 C2H2 Zn finger 338..357 CDD:275368 11/18 (61%)
zf-H2C2_2 349..374 CDD:290200 19/26 (73%)
C2H2 Zn finger 365..385 CDD:275368 15/21 (71%)
zf-H2C2_2 377..402 CDD:290200 15/24 (63%)
zf-C2H2 391..413 CDD:278523 15/21 (71%)
C2H2 Zn finger 393..413 CDD:275368 14/19 (74%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.