DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOX12 and D

DIOPT Version :10

Sequence 1:NP_008874.2 Gene:SOX12 / 6666 HGNCID:11198 Length:315 Species:Homo sapiens
Sequence 2:NP_524066.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster


Alignment Length:133 Identity:69/133 - (51%)
Similarity:86/133 - (64%) Gaps:16/133 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    27 AREPGWCKTPSGHIKRPMNAFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQLLQDSEKIPFVR 91
            |..||    ..||||||||||||||:.:||:|....|.|||:|||||||..|:||.:|||.||:.
  Fly   133 ATSPG----QEGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFID 193

Human    92 EAERLRLKHMADYPDYKYRPRKKSKGAPAKARPRPPGGSGGGSRLKPGPQLPGRGGRRAAGGPLG 156
            ||:|||..||.::||||||||:|.|. |..|.|:      ||.:::.|    |.|.::...|| |
  Fly   194 EAKRLRALHMKEHPDYKYRPRRKPKN-PLTAGPQ------GGLQMQAG----GMGQQKLGAGP-G 246

Human   157 GGA 159
            .||
  Fly   247 AGA 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOX12NP_008874.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 4/12 (33%)
HMG-box_SF 29..116 CDD:469606 54/86 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..288 25/60 (42%)
Required for transcriptional activation activity and synergistic coactivation of transcriptional activity with POU3F2. /evidence=ECO:0000250|UniProtKB:Q04890 283..315
DNP_524066.1 HMG-box_SoxB 140..219 CDD:438790 52/78 (67%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.