DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOX12 and Sox14

DIOPT Version :10

Sequence 1:NP_008874.2 Gene:SOX12 / 6666 HGNCID:11198 Length:315 Species:Homo sapiens
Sequence 2:NP_476894.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster


Alignment Length:273 Identity:86/273 - (31%)
Similarity:121/273 - (44%) Gaps:77/273 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    16 PPPGP-------GPAEEG------------------AREPGWCKTP-----------SGHIKRPM 44
            |||..       .|:..|                  ||.|....||           .|||||||
  Fly   127 PPPRESEMDGERSPSHSGHEMTLSMDGIDSSLVFGSARVPVNSSTPYSDATRTKKHSPGHIKRPM 191

Human    45 NAFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQLLQDSEKIPFVREAERLRLKHMADYPDYKY 109
            ||||||||.|||||.::.||:|||||||.||||||||...:|.|::.|||:||..||.:||:|||
  Fly   192 NAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLHMIEYPNYKY 256

Human   110 RPRKKSKGAPAKARPRPPGGSGGGSRLKPGPQLPGRGGRRAAGGPLGGGAAAPEDDDEDDDEELL 174
            ||:||        :.|.||.      |||.....|...|               :|..:::..|.
  Fly   257 RPQKK--------QTRSPGS------LKPNQDADGCEAR---------------NDTTNNNNSLT 292

Human   175 EVRLVETPGRELWRMVPAGRAARGQAERAQGPSGEGAAAAAAASPTPSEDEEPEEEEEEAAAAEE 239
            .:.:..|        ..|||    :::|:......|:|:....:.:.....:|:.|.:..:|.:.
  Fly   293 TLAINGT--------TTAGR----KSKRSTSTCQSGSASKRLRNDSGDTSSKPKYEVKMESAEQL 345

Human   240 GEEETVASGEESL 252
            ...:.:....::|
  Fly   346 NSADIILPSADNL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOX12NP_008874.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 11/59 (19%)
HMG-box_SF 29..116 CDD:469606 58/97 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..288 32/153 (21%)
Required for transcriptional activation activity and synergistic coactivation of transcriptional activity with POU3F2. /evidence=ECO:0000250|UniProtKB:Q04890 283..315
Sox14NP_476894.1 HMG-box_SoxC 186..261 CDD:438838 52/74 (70%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.