DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOX12 and HmgD

DIOPT Version :10

Sequence 1:NP_008874.2 Gene:SOX12 / 6666 HGNCID:11198 Length:315 Species:Homo sapiens
Sequence 2:NP_726109.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster


Alignment Length:132 Identity:35/132 - (26%)
Similarity:56/132 - (42%) Gaps:27/132 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    41 KRPMNAFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQLLQDSEKIPFVREAERLRLKHMADYP 105
            |||::|:|:|....|..|..:.|.:...|::||.|..|:.::|..      |.|....|...|| 
  Fly     6 KRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKS------EWEAKAAKAKDDY- 63

Human   106 DYKYRPRKKSKGAPAKARPRPPGGSGGGSRLKPGPQLPGRGGRRAAGGPLGGGAAAPEDDDEDDD 170
            |...:..:.:.|:.|      ..|.|...|.||..::..:..:              |:.|||||
  Fly    64 DRAVKEFEANGGSSA------ANGGGAKKRAKPAKKVAKKSKK--------------EESDEDDD 108

Human   171 EE 172
            :|
  Fly   109 DE 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOX12NP_008874.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
HMG-box_SF 29..116 CDD:469606 21/74 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..288 17/73 (23%)
Required for transcriptional activation activity and synergistic coactivation of transcriptional activity with POU3F2. /evidence=ECO:0000250|UniProtKB:Q04890 283..315
HmgDNP_726109.1 HMG-box_SSRP1-like 7..71 CDD:438810 20/70 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.