DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOX12 and HmgZ

DIOPT Version :10

Sequence 1:NP_008874.2 Gene:SOX12 / 6666 HGNCID:11198 Length:315 Species:Homo sapiens
Sequence 2:NP_726106.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster


Alignment Length:131 Identity:33/131 - (25%)
Similarity:53/131 - (40%) Gaps:28/131 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    41 KRPMNAFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQLLQDSEKIPFVREAERLRLKHMADYP 105
            |||::|:|:|....|.:|....|.....:|:||.|..|:.|:|.      .|.|:..:|...:| 
  Fly     7 KRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLKDK------TEWEQKAIKMKEEY- 64

Human   106 DYKYRPRKKSKGAPAKARPRPPGGSGGGSRLKPGPQLPGRGGRRAAGGPLGGGAAAPEDDDEDDD 170
                  .|..|...|.      ||:..|:..|         .::||..|..........::|::|
  Fly    65 ------NKAVKEYEAN------GGTDSGAPKK---------RKKAAAKPAKKAKKKESSEEEEED 108

Human   171 E 171
            |
  Fly   109 E 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOX12NP_008874.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
HMG-box_SF 29..116 CDD:469606 21/74 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..288 14/72 (19%)
Required for transcriptional activation activity and synergistic coactivation of transcriptional activity with POU3F2. /evidence=ECO:0000250|UniProtKB:Q04890 283..315
HmgZNP_726106.1 HMG-box_SSRP1-like 8..72 CDD:438810 21/76 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.