DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOX12 and Sox15

DIOPT Version :9

Sequence 1:NP_008874.2 Gene:SOX12 / 6666 HGNCID:11198 Length:315 Species:Homo sapiens
Sequence 2:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster


Alignment Length:281 Identity:84/281 - (29%)
Similarity:137/281 - (48%) Gaps:45/281 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    20 PGPAEEGAREPGWCKTPS---GHIKRPMNAFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQLL 81
            |.||:...| ||..::.|   ..|:|||||||||::.||:|:.|:.||:|||::||.||::|:.|
  Fly   193 PLPADLKYR-PGGTQSKSAKESRIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSL 256

Human    82 QDSEKIPFVREAERLRLKHMADYPDYKYRPRKKSKGAPAKARPRPPGGSGGGSRLKPGPQLPGRG 146
            ...::.|:|.||||||:.||.::|:||||||::.:   :|.|...|||.   .:.:..|. ||.|
  Fly   257 TPQDRRPYVEEAERLRVIHMTEHPNYKYRPRRRKQ---SKLRAMQPGGK---EQSESSPN-PGTG 314

Human   147 GRRA----AGGPLGGGAAA---PEDDD-----EDDDEELLEVRLVETPGRELWRMVPAGRAARGQ 199
            |.::    |..||...:::   |.|:.     ..:..:.....|.|.|.:..:.  |:.......
  Fly   315 GSKSNPKLATPPLATASSSYTTPTDESTCNSTNQNHGQSTPGGLYEQPLKPTYS--PSSVDCYSN 377

Human   200 AERAQGPSGEGAAAAAA----ASPT---------------PSEDEEPEEEEEEAAAAEEGEEETV 245
            |:..:......|....|    :|||               ||.....:..:|:.|.:||..:.:.
  Fly   378 ADSTEQIESLAANCPPALLNESSPTGGGYDNSLLLKKLTKPSPSRAAKSRQEKLAKSEEKNKGSQ 442

Human   246 ASGEESLG-FLSRLPPGPAGL 265
            :.|:...| :.:..|..|..:
  Fly   443 SQGQSQQGIYAATYPLAPTSV 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOX12NP_008874.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 7/22 (32%)
SOX-TCF_HMG-box 39..110 CDD:238684 38/70 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..288 44/198 (22%)
Required for transcriptional activation activity and synergistic coactivation of transcriptional activity with POU3F2. /evidence=ECO:0000250|UniProtKB:Q04890 283..315
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 38/70 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148503
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.