DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOX12 and Sox15

DIOPT Version :10

Sequence 1:NP_008874.2 Gene:SOX12 / 6666 HGNCID:11198 Length:315 Species:Homo sapiens
Sequence 2:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster


Alignment Length:281 Identity:84/281 - (29%)
Similarity:137/281 - (48%) Gaps:45/281 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    20 PGPAEEGAREPGWCKTPS---GHIKRPMNAFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQLL 81
            |.||:...| ||..::.|   ..|:|||||||||::.||:|:.|:.||:|||::||.||::|:.|
  Fly   193 PLPADLKYR-PGGTQSKSAKESRIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSL 256

Human    82 QDSEKIPFVREAERLRLKHMADYPDYKYRPRKKSKGAPAKARPRPPGGSGGGSRLKPGPQLPGRG 146
            ...::.|:|.||||||:.||.::|:||||||::.:   :|.|...|||.   .:.:..|. ||.|
  Fly   257 TPQDRRPYVEEAERLRVIHMTEHPNYKYRPRRRKQ---SKLRAMQPGGK---EQSESSPN-PGTG 314

Human   147 GRRA----AGGPLGGGAAA---PEDDD-----EDDDEELLEVRLVETPGRELWRMVPAGRAARGQ 199
            |.::    |..||...:::   |.|:.     ..:..:.....|.|.|.:..:.  |:.......
  Fly   315 GSKSNPKLATPPLATASSSYTTPTDESTCNSTNQNHGQSTPGGLYEQPLKPTYS--PSSVDCYSN 377

Human   200 AERAQGPSGEGAAAAAA----ASPT---------------PSEDEEPEEEEEEAAAAEEGEEETV 245
            |:..:......|....|    :|||               ||.....:..:|:.|.:||..:.:.
  Fly   378 ADSTEQIESLAANCPPALLNESSPTGGGYDNSLLLKKLTKPSPSRAAKSRQEKLAKSEEKNKGSQ 442

Human   246 ASGEESLG-FLSRLPPGPAGL 265
            :.|:...| :.:..|..|..:
  Fly   443 SQGQSQQGIYAATYPLAPTSV 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOX12NP_008874.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 7/22 (32%)
HMG-box_SF 29..116 CDD:469606 45/89 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..288 44/198 (22%)
Required for transcriptional activation activity and synergistic coactivation of transcriptional activity with POU3F2. /evidence=ECO:0000250|UniProtKB:Q04890 283..315
Sox15NP_523739.2 HMG-box_SoxF 214..289 CDD:438841 42/74 (57%)
PHA03273 305..>391 CDD:223031 16/88 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.