DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOX15 and Sox14

DIOPT Version :10

Sequence 1:NP_008873.1 Gene:SOX15 / 6665 HGNCID:11196 Length:233 Species:Homo sapiens
Sequence 2:NP_476894.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster


Alignment Length:195 Identity:61/195 - (31%)
Similarity:95/195 - (48%) Gaps:69/195 - (35%)


- Green bases have known domain annotations that are detailed below.


Human     4 PGS--SQDQAWSLEP-----PAATAAASSSSGPQ-------------------------EREGAG 36
            ||:  :|.||....|     |:|..||::...|:                         |.:|..
  Fly    74 PGAQKTQSQAAITHPAAVASPSAPVAAAAPKTPKTPEPRSTHTHTHTHSQHFSPPPRESEMDGER 138

Human    37 SPAAPG---TLPLE---------------------------------KVKRPMNAFMVWSSAQRR 65
            ||:..|   ||.::                                 .:|||||||||||..:||
  Fly   139 SPSHSGHEMTLSMDGIDSSLVFGSARVPVNSSTPYSDATRTKKHSPGHIKRPMNAFMVWSQMERR 203

Human    66 QMAQQNPKMHNSEISKRLGAQWKLLDEDEKRPFVEEAKRLRARHLRDYPDYKYRPRRK-AKSSGA 129
            ::.::.|.:||:||||.||.:|:||.:|:|:|::.||::||..|:.:||:|||||::| .:|.|:
  Fly   204 KICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLHMIEYPNYKYRPQKKQTRSPGS 268

Human   130  129
              Fly   269  268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOX15NP_008873.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48 18/111 (16%)
Required to promote HAND1 transcriptional activator activity. /evidence=ECO:0000250|UniProtKB:P43267 1..47 18/77 (23%)
HMG-box_SoxA_SoxB_SoxG 48..123 CDD:438837 40/74 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..153 10/18 (56%)
Interaction with FHL3. /evidence=ECO:0000250|UniProtKB:P43267 138..183
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..233
Sox14NP_476894.1 HMG-box_SoxC 186..261 CDD:438838 40/74 (54%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.