| Sequence 1: | NP_008873.1 | Gene: | SOX15 / 6665 | HGNCID: | 11196 | Length: | 233 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_476894.1 | Gene: | Sox14 / 37822 | FlyBaseID: | FBgn0005612 | Length: | 669 | Species: | Drosophila melanogaster |
| Alignment Length: | 195 | Identity: | 61/195 - (31%) |
|---|---|---|---|
| Similarity: | 95/195 - (48%) | Gaps: | 69/195 - (35%) |
- Green bases have known domain annotations that are detailed below.
|
Human 4 PGS--SQDQAWSLEP-----PAATAAASSSSGPQ-------------------------EREGAG 36
Human 37 SPAAPG---TLPLE---------------------------------KVKRPMNAFMVWSSAQRR 65
Human 66 QMAQQNPKMHNSEISKRLGAQWKLLDEDEKRPFVEEAKRLRARHLRDYPDYKYRPRRK-AKSSGA 129
Human 130 129 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| SOX15 | NP_008873.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..48 | 18/111 (16%) | |
| Required to promote HAND1 transcriptional activator activity. /evidence=ECO:0000250|UniProtKB:P43267 | 1..47 | 18/77 (23%) | |||
| HMG-box_SoxA_SoxB_SoxG | 48..123 | CDD:438837 | 40/74 (54%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 113..153 | 10/18 (56%) | |||
| Interaction with FHL3. /evidence=ECO:0000250|UniProtKB:P43267 | 138..183 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 208..233 | ||||
| Sox14 | NP_476894.1 | HMG-box_SoxC | 186..261 | CDD:438838 | 40/74 (54%) |
| Blue background indicates that the domain is not in the aligned region. | |||||