DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOX15 and Sox15

DIOPT Version :10

Sequence 1:NP_008873.1 Gene:SOX15 / 6665 HGNCID:11196 Length:233 Species:Homo sapiens
Sequence 2:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster


Alignment Length:184 Identity:64/184 - (34%)
Similarity:97/184 - (52%) Gaps:32/184 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    48 KVKRPMNAFMVWSSAQRRQMAQQNPKMHNSEISKRLGAQWKLLDEDEKRPFVEEAKRLRARHLRD 112
            :::|||||||||:..:|:::|.:||.:||:::||.||.:|:.|...::||:||||:|||..|:.:
  Fly   214 RIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTE 278

Human   113 YPDYKYRPRR----KAKSSGAGPSRCGQGRGNLASGGPLWGPGYATTQPSRGFGYRPPSYSTAYL 173
            :|:|||||||    |.::...|.....:...|..:||....|..||           |..:||  
  Fly   279 HPNYKYRPRRRKQSKLRAMQPGGKEQSESSPNPGTGGSKSNPKLAT-----------PPLATA-- 330

Human   174 PGSYGSSHCKLEAPSPCSLP-----QSDP--RLQGELLPTYTHYLPPGSPTPYN 220
                .||:......|.|:..     ||.|  ..:..|.|||:    |.|...|:
  Fly   331 ----SSSYTTPTDESTCNSTNQNHGQSTPGGLYEQPLKPTYS----PSSVDCYS 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOX15NP_008873.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48 64/184 (35%)
Required to promote HAND1 transcriptional activator activity. /evidence=ECO:0000250|UniProtKB:P43267 1..47
HMG-box_SoxA_SoxB_SoxG 48..123 CDD:438837 39/78 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..153 14/43 (33%)
Interaction with FHL3. /evidence=ECO:0000250|UniProtKB:P43267 138..183 11/44 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..233 3/13 (23%)
Sox15NP_523739.2 HMG-box_SoxF 214..289 CDD:438841 38/74 (51%)
PHA03273 305..>391 CDD:223031 23/93 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.