DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOX15 and Sox15

DIOPT Version :9

Sequence 1:NP_008873.1 Gene:SOX15 / 6665 HGNCID:11196 Length:233 Species:Homo sapiens
Sequence 2:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster


Alignment Length:184 Identity:64/184 - (34%)
Similarity:97/184 - (52%) Gaps:32/184 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    48 KVKRPMNAFMVWSSAQRRQMAQQNPKMHNSEISKRLGAQWKLLDEDEKRPFVEEAKRLRARHLRD 112
            :::|||||||||:..:|:::|.:||.:||:::||.||.:|:.|...::||:||||:|||..|:.:
  Fly   214 RIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTE 278

Human   113 YPDYKYRPRR----KAKSSGAGPSRCGQGRGNLASGGPLWGPGYATTQPSRGFGYRPPSYSTAYL 173
            :|:|||||||    |.::...|.....:...|..:||....|..||           |..:||  
  Fly   279 HPNYKYRPRRRKQSKLRAMQPGGKEQSESSPNPGTGGSKSNPKLAT-----------PPLATA-- 330

Human   174 PGSYGSSHCKLEAPSPCSLP-----QSDP--RLQGELLPTYTHYLPPGSPTPYN 220
                .||:......|.|:..     ||.|  ..:..|.|||:    |.|...|:
  Fly   331 ----SSSYTTPTDESTCNSTNQNHGQSTPGGLYEQPLKPTYS----PSSVDCYS 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOX15NP_008873.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48 64/184 (35%)
Required to promote HAND1 transcriptional activator activity. /evidence=ECO:0000250|UniProtKB:P43267 1..47
SOX-TCF_HMG-box 48..119 CDD:238684 34/70 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..153 14/43 (33%)
Interaction with FHL3. /evidence=ECO:0000250|UniProtKB:P43267 138..183 11/44 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..233 3/13 (23%)
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 34/70 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148501
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.