DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOX11 and Sox100B

DIOPT Version :9

Sequence 1:NP_003099.1 Gene:SOX11 / 6664 HGNCID:11191 Length:441 Species:Homo sapiens
Sequence 2:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster


Alignment Length:455 Identity:129/455 - (28%)
Similarity:178/455 - (39%) Gaps:156/455 - (34%)


- Green bases have known domain annotations that are detailed below.


Human    48 HIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMAD 112
            ||||||||||||::..||.:.:|.|.:.|:|:||.|||.||.||||:|.||:..||:||:.|..:
  Fly    76 HIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQE 140

Human   113 YPDYKYRPRKK-----------------PKMDPSAKPSASQSPEKSAAGG----GGGSAGGGAG- 155
            :|||||:||:|                 |:|..||...:|..|..|.:.|    |.|:|....| 
  Fly   141 HPDYKYQPRRKKARVLPSQQSGEGGSPGPEMTLSATMGSSGKPRSSNSNGQRRAGKGNAAADLGS 205

Human   156 ----------GAKTS---------KGSSKKCGK-----------LKAP----------------- 173
                      |:.:|         |..:..|..           |.:|                 
  Fly   206 CASTISHANVGSNSSDVFSNEAFMKSLNSACAASLMEQSLIETGLDSPCSTASSMSSLTPPATPY 270

Human   174 --AAAGAKAGAGK------------AAQSGD-YG---GAGDDYV-LGSLRV--------SGSGGG 211
              |.:.|||.|..            .|.:|| ||   .||.:|| :|.:..        ||:.||
  Fly   271 NVAPSNAKASAANNPSLLLRQLSEPVANAGDGYGVLLEAGREYVAIGEVNYQGQSAGVQSGAEGG 335

Human   212 GAGKTVKCVFLDE-DDDDDDDDDELQLQIKQEPDE----EDEEPPHQQLLQPPGQQPSQLLRRYN 271
            |||:.:.  ||:. :.........:.......|..    ..||...||.|     |.|:.| .|.
  Fly   336 GAGQEMD--FLENINGYGGYTGSRVSYPAYSYPANGGHFATEEQQQQQAL-----QASEAL-NYK 392

Human   272 VAKVPASPTLSSSAESPEGASLY--DEVRAGATSGAGGGSRLYYSFKNITKQHPP----PLAQPA 330
                ||:..:     .|:....|  |::..                  :|:.|.|    ||..|.
  Fly   393 ----PAAADI-----DPKEIDQYFMDQMLP------------------MTQHHHPHHTHPLHHPL 430

Human   331 -LSPASSRSVSTSSSSSSGSSSGSSGEDADDLMFDLSLNFSQSAHSAS-------EQQLGGGAAA 387
             .||..:.|.|.||:.||.||.....|      :...|.:|.:|.|||       :|....|||:
  Fly   431 HHSPPLNSSASLSSACSSASSQQPVAE------YYEHLGYSPAASSASQNPNFGPQQPYANGAAS 489

Human   388  387
              Fly   490  489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOX11NP_003099.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
SOX-TCF_HMG-box 48..119 CDD:238684 41/70 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..216 46/195 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..292 13/55 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 319..359 17/44 (39%)
Required for transcriptional activation activity and synergistic coactivation of transcriptional activity with POU3F2. /evidence=ECO:0000250|UniProtKB:Q7M6Y2 409..441
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 40/69 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.