DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOX11 and Sox15

DIOPT Version :9

Sequence 1:NP_003099.1 Gene:SOX11 / 6664 HGNCID:11191 Length:441 Species:Homo sapiens
Sequence 2:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster


Alignment Length:427 Identity:108/427 - (25%)
Similarity:181/427 - (42%) Gaps:108/427 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    49 IKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADY 113
            |:|||||||||:||||:|:.:::||:|||::||.|||:|:.|...::.|::.||||||:.||.::
  Fly   215 IRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTEH 279

Human   114 PDYKYRPRKKPK-----MDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKKCGKLKAP 173
            |:||||||::.:     |.|..|..:..||..            |.||:|::.       ||..|
  Fly   280 PNYKYRPRRRKQSKLRAMQPGGKEQSESSPNP------------GTGGSKSNP-------KLATP 325

Human   174 AAAGAKAGAGKAAQSGDYGGAGDDYVLGSLRVS---GSGGGGAGKTVKCVFLDEDDD---DDDDD 232
            ..|.|         |..|....|:....|...:   .:.||...:.:|..:.....|   :.|..
  Fly   326 PLATA---------SSSYTTPTDESTCNSTNQNHGQSTPGGLYEQPLKPTYSPSSVDCYSNADST 381

Human   233 DELQ-LQIKQEPDEEDEEPPHQQLLQPPGQQPSQLLRRYNVAKVPASPT---------LSSSAES 287
            :::: |.....|...:|..|     ...|...|.||::.    ...||:         |:.|.|.
  Fly   382 EQIESLAANCPPALLNESSP-----TGGGYDNSLLLKKL----TKPSPSRAAKSRQEKLAKSEEK 437

Human   288 PEGASLYDEVRAG---------ATSGAGGGSR-LYYSFKN---ITKQH--------PPPLAQPAL 331
            .:|:....:.:.|         .||.|...:| :|.:..|   :...|        |..:::...
  Fly   438 NKGSQSQGQSQQGIYAATYPLAPTSVAVVAARGMYVTCNNRGLLDHGHSVKGTFYPPVSVSEDDN 502

Human   332 SPASSRSVS---------TSSSSSSGSSSGSSGEDADDLMFDLSLNFSQSAHSASEQQLGGGAAA 387
            |.:...|:|         ||:.||||.:..:|               ..|:::.|...     ..
  Fly   503 STSMRNSISALQQHCNVVTSTPSSSGGTMPTS---------------EMSSYTVSMAD-----NC 547

Human   388 GNLSLSLVDKDLDSFSEGSLGSHFEFPDYCTPELSEM 424
            |||.||:.:...:.:...:.....::.|:...:.::|
  Fly   548 GNLRLSMNELSGNEYLPSANAYGMQYEDFLRYQSNDM 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOX11NP_003099.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
SOX-TCF_HMG-box 48..119 CDD:238684 39/69 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..216 26/107 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..292 13/60 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 319..359 12/56 (21%)
Required for transcriptional activation activity and synergistic coactivation of transcriptional activity with POU3F2. /evidence=ECO:0000250|UniProtKB:Q7M6Y2 409..441 2/16 (13%)
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 39/69 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.