DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Thg1l and THG

DIOPT Version :9

Sequence 1:NP_001074438.1 Gene:Thg1l / 66628 MGIID:1913878 Length:298 Species:Mus musculus
Sequence 2:NP_001188815.1 Gene:THG / 34876 FlyBaseID:FBgn0283659 Length:286 Species:Drosophila melanogaster


Alignment Length:267 Identity:149/267 - (55%)
Similarity:190/267 - (71%) Gaps:19/267 - (7%)


- Green bases have known domain annotations that are detailed below.


Mouse    30 MAKSKFEYVRNFEVQDTCLPHCWVVVRLDGRNFHRFAEEHNFAKPNDSRALHLMTKCAQTVMEEL 94
            ||.|:||||::||..|:.||:.|:|:|:||:.||:|::.|:|.||||..||::|...|..||:|.
  Fly     1 MACSRFEYVKSFEQDDSILPNVWIVIRIDGKKFHKFSKTHDFEKPNDENALNVMNAAATAVMQEF 65

Mouse    95 EDIVIAYGQSDEYSFVFRKKSNWFKRRASKFMTLVASQFASSYVFYWRDYFEDQPLRYPPGFDGR 159
            .|||:||||||||||||||::..||||::|.:|.|.|.|:||||..|..:. :.||.|.|.||||
  Fly    66 RDIVLAYGQSDEYSFVFRKETAAFKRRSAKLLTYVTSLFSSSYVMQWSKWM-NLPLAYAPCFDGR 129

Mouse   160 VVLYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQQRLKGTLTADKNEILFSEF 224
            ||||||.|.|||||||||||.|:||||||.||.|:.:.|||..||:.:|:||.:|||||:||.||
  Fly   130 VVLYPSEQNLKDYLSWRQADVHVNNLYNTAFWKLVLEKGLTNQQAEAKLRGTFSADKNELLFQEF 194

Mouse   225 HINYNNEPHMYRKGTVLVWQKVEEVRTQEVRLPAEMEGEKKAVARTRTRVVALNCDLIGDAFWKE 289
            .|||||.|.||||||:|:.::|             :.|||     :|..||.|:.|||...||||
  Fly   195 GINYNNLPAMYRKGTILLRKRV-------------ILGEK-----SRQAVVPLHEDLISSQFWKE 241

Mouse   290 HPEILAE 296
            |.|||.:
  Fly   242 HTEILGK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Thg1lNP_001074438.1 Thg1 31..291 CDD:226508 144/259 (56%)
THGNP_001188815.1 Thg1 2..239 CDD:226508 140/255 (55%)
Thg1 9..134 CDD:282322 69/125 (55%)
Thg1C 137..234 CDD:291110 61/114 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849789
Domainoid 1 1.000 161 1.000 Domainoid score I4015
eggNOG 1 0.900 - - E1_COG4021
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5959
Inparanoid 1 1.050 300 1.000 Inparanoid score I2676
Isobase 1 0.950 - 0 Normalized mean entropy S995
OMA 1 1.010 - - QHG54375
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004478
OrthoInspector 1 1.000 - - oto92083
orthoMCL 1 0.900 - - OOG6_103009
Panther 1 1.100 - - LDO PTHR12729
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1510
SonicParanoid 1 1.000 - - X3173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.