DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdip1 and CG32280

DIOPT Version :9

Sequence 1:NP_001345008.1 Gene:Cdip1 / 66626 MGIID:1913876 Length:229 Species:Mus musculus
Sequence 2:NP_001286927.1 Gene:CG32280 / 317952 FlyBaseID:FBgn0052280 Length:130 Species:Drosophila melanogaster


Alignment Length:146 Identity:52/146 - (35%)
Similarity:68/146 - (46%) Gaps:20/146 - (13%)


- Green bases have known domain annotations that are detailed below.


Mouse    84 QPGFVPPHMNADGTYMPAGFYPPPGPHPPMGYYPPGPYPPGPYPGPGGHT--ATVLVPSGAATTV 146
            :||..||..    ||:|....||.......|..|.|||.|...|....:|  .|.:||....:| 
  Fly     3 KPGSAPPQF----TYVPPPSAPPSYQEAVGGVKPVGPYTPVVAPATTANTTIVTTVVPISRTST- 62

Mouse   147 TVLQGEIFEGAPVQTVCPHCQQAITTKISYEIGLMNFVLGFFCCFMGCDLGCCLIPCLINDFKDV 211
                         ..:||.|...|.|....|.|::.::.||.....||.||||||||.|:|..||
  Fly    63 -------------HMICPSCHAEIETTTRTEPGMIAYLSGFLIALFGCWLGCCLIPCCIDDCMDV 114

Mouse   212 THTCPSCKAYICTYKR 227
            .|:||:|:||:..|:|
  Fly   115 HHSCPNCRAYLGRYRR 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdip1NP_001345008.1 zf-LITAF-like 158..224 CDD:313756 29/65 (45%)
CG32280NP_001286927.1 zf-LITAF-like 60..129 CDD:402300 30/82 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 75 1.000 Domainoid score I9049
eggNOG 1 0.900 - - E1_2CY6X
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I5046
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm11118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5213
SonicParanoid 1 1.000 - - X238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.960

Return to query results.
Submit another query.