DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOX5 and Sox15

DIOPT Version :9

Sequence 1:XP_016875377.1 Gene:SOX5 / 6660 HGNCID:11201 Length:793 Species:Homo sapiens
Sequence 2:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster


Alignment Length:364 Identity:99/364 - (27%)
Similarity:159/364 - (43%) Gaps:80/364 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   453 NSGAGPLKASVPAALASPSAR---VSTIGYLNDH--DAVTKAIQEARQMKEQLRREQQVLDGKVA 512
            ||.||.......:..:|||..   :.:.||.|:|  :||..|...:......:  ....:.|..|
  Fly    56 NSDAGIYHVRQGSEHSSPSLHSPAIQSSGYENEHLNEAVLAAHSHSHSPMPMV--SSAYVGGGTA 118

Human   513 ---VVNS----LG------LNNCRTEKEKTTLESLTQQLAVKQNEEGKFSH------AMMDFNLS 558
               ::||    ||      ||...:......:...|.|:      |...||      :|..::..
  Fly   119 SGSLINSNIPLLGGGGNSVLNKFLSHPHAGMVGGGTGQM------EDCTSHSPIEAASMWSYDYK 177

Human   559 GD-SDGSAGVSESR-------IYRE--SRGRGSNEPHIKRPMNAFMVWAKDERRKILQAFPDMHN 613
            || ...:.|..|..       .||.  ::.:.:.|..|:|||||||||||.||:|:....||:||
  Fly   178 GDLCAPNCGYLERHKPLPADLKYRPGGTQSKSAKESRIRRPMNAFMVWAKIERKKLADENPDLHN 242

Human   614 SNISKILGSRWKAMTNLEKQPYYEEQARLSKQHLEKYPDYKYKPRPKRTCLVDGKKLRIGEYKAI 678
            :::||:||.:|:::|..:::||.||..||...|:.::|:|||:||.::.     .|||     |:
  Fly   243 ADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTEHPNYKYRPRRRKQ-----SKLR-----AM 297

Human   679 MRNRRQEMRQYFNVG--------QQAQIPIATAGVVYPGAIAMAGMPSPHLPSEHSSVSSSPE-P 734
            ....:::.....|.|        :.|..|:|||...|.            .|::.|:.:|:.: .
  Fly   298 QPGGKEQSESSPNPGTGGSKSNPKLATPPLATASSSYT------------TPTDESTCNSTNQNH 350

Human   735 GMPVIQSTYGVKGEEPHIKEEIQAEDINGEIYDEYDEEE 773
            |    |||.|...|:| :|.......:  :.|...|..|
  Fly   351 G----QSTPGGLYEQP-LKPTYSPSSV--DCYSNADSTE 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOX5XP_016875377.1 None
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 35/70 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.