DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOX4 and cic

DIOPT Version :9

Sequence 1:NP_003098.1 Gene:SOX4 / 6659 HGNCID:11200 Length:474 Species:Homo sapiens
Sequence 2:NP_001262755.1 Gene:cic / 53560 FlyBaseID:FBgn0262582 Length:2150 Species:Drosophila melanogaster


Alignment Length:486 Identity:106/486 - (21%)
Similarity:163/486 - (33%) Gaps:157/486 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    41 STGGKADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDK 105
            :.|..|..|:     :..|:|||||||::|:..|:.:.::.|:..|..:||.||:.|..||...|
  Fly  1219 AAGTAAGQPA-----NKKIRRPMNAFMIFSKKHRKMVHKKHPNQDNRTVSKILGEWWYALKPEQK 1278

Human   106 IPFIREAERLRLKHMADYPDYKYRPRKKVKSGNANSSSSAAASSKPGEKGDKVGGSGGGGHGGGG 170
            ..:...|..::..|...:|::|:..:.:.||    |:|:|.    ||.|.....|:|........
  Fly  1279 AQYHELASSVKDAHFKLHPEWKWCSKDRRKS----STSTAT----PGGKASGAAGTGDAKQRLVS 1335

Human   171 GGGSSN-------AGGGGGGASGGGANSKPAQ-----------KKSCGSKVAGGAGGGVSKPHAK 217
            ..||.:       :..||.|:.||...|...|           ..:|...             ..
  Fly  1336 VDGSDSLEHDMCPSTPGGSGSCGGQGISSDLQGDIIPLTIDNYNSTCDEA-------------PT 1387

Human   218 LILAGGGGGGKAAAAAAASFAAEQAGAAALLPLGAAADHHSL----------------------Y 260
            .|...|.|.||.......|...||     :|.:.......::                      |
  Fly  1388 TISMKGNGNGKLMKNELPSDEDEQ-----MLVVEEEQQQQTVKKIDLHCRERVNDSDMDDTPFDY 1447

Human   261 KARTP-----SASASASSAASASAALAAP---GKH---LAEKKVK---------------RVYL- 298
            :.:.|     ||...::|.|:..|..|.|   |:.   |..|.:|               .:|. 
  Fly  1448 RKQQPEANQRSAEEHSTSGANGQAINAPPLSGGEREITLKPKAIKAHPVLESNMLPYTQMSIYTQ 1512

Human   299 ---------------FGGLGTSSSPVGGVGAGADPSDPLGL---YEEEGAGCSPDAP-SLSGRSS 344
                           .|| ...|.|:...|:|..|.|...|   .::|.....|.:| .|:..|.
  Fly  1513 YTSPKNPIGVTPFQPTGG-AFKSMPISPKGSGGKPEDAGSLQAHIKQEDIKQEPPSPYKLNNGSG 1576

Human   345 AASS--------PAAGRSPA-----------------------DHRGYASLRAASPA--PSSAP- 375
            :||.        |.:|...|                       .||....||||..|  |||.. 
  Fly  1577 SASGGGVVSAPPPNSGSVGAIFNFNVPTATALSQKQFHYPMHHPHRSPTDLRAAHQACVPSSPAG 1641

Human   376 ---SHASSSASSHSSSSSS--SGSSSSDDEF 401
               .||::.|:..:|:.:.  .|..:|...|
  Fly  1642 MGLGHAANIATPPASAPAQIMGGGPASQKMF 1672

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOX4NP_003098.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58 3/16 (19%)
SOX-TCF_HMG-box 58..129 CDD:238684 24/70 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..228 23/117 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..286 8/31 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..416 34/143 (24%)
cicNP_001262755.1 DUF4819 349..431 CDD:292708
SOX-TCF_HMG-box 1231..1302 CDD:238684 24/70 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.