DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOX3 and Sox15

DIOPT Version :9

Sequence 1:NP_005625.2 Gene:SOX3 / 6658 HGNCID:11199 Length:446 Species:Homo sapiens
Sequence 2:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster


Alignment Length:469 Identity:115/469 - (24%)
Similarity:175/469 - (37%) Gaps:170/469 - (36%)


- Green bases have known domain annotations that are detailed below.


Human    94 AAGTGGPAAPGGAGKSSANAAGGANSGGGSS----------GGASGGG----------------- 131
            :|..||..|.|....|:....|    |||:|          .|..|||                 
  Fly   110 SAYVGGGTASGSLINSNIPLLG----GGGNSVLNKFLSHPHAGMVGGGTGQMEDCTSHSPIEAAS 170

Human   132 --------------------------------GGTD-----QDRVKRPMNAFMVWSRGQRRKMAL 159
                                            |||.     :.|::|||||||||::.:|:|:|.
  Fly   171 MWSYDYKGDLCAPNCGYLERHKPLPADLKYRPGGTQSKSAKESRIRRPMNAFMVWAKIERKKLAD 235

Human   160 ENPKMHNSEISKRLGADWKLLTDAEKRPFIDEAKRLRAVHMKEYPDYKYRPRRKTKTLL------ 218
            |||.:||:::||.||..|:.||..::||:::||:|||.:||.|:|:|||||||:.::.|      
  Fly   236 ENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTEHPNYKYRPRRRKQSKLRAMQPG 300

Human   219 -KKDKYSLPSGLLPPGAAAAAA----AAAAAAAAASS---------------------PVGVGQR 257
             |:...|.|:    ||...:.:    |....|.|:||                     |.|:.::
  Fly   301 GKEQSESSPN----PGTGGSKSNPKLATPPLATASSSYTTPTDESTCNSTNQNHGQSTPGGLYEQ 361

Human   258 --LDTY--THVNGWANGAYSLVQEQLGYAQPPSMSSPPPPPALPPMHRYDMAGLQYSPMMPPGAQ 318
              ..||  :.|:.::|...:...|.|....||::.:...|..    ..||.:.|......|..::
  Fly   362 PLKPTYSPSSVDCYSNADSTEQIESLAANCPPALLNESSPTG----GGYDNSLLLKKLTKPSPSR 422

Human   319 SYMN----VAAAAAAASGYGGMAPSATAAAAAAYGQQPATAAAAAAAAAAMSLGPMG-------- 371
            :..:    :|.:.....|......|.....||.|...|.:.|..||....::....|        
  Fly   423 AAKSRQEKLAKSEEKNKGSQSQGQSQQGIYAATYPLAPTSVAVVAARGMYVTCNNRGLLDHGHSV 487

Human   372 ------------------------------SVVKSEPSS-----PPPAIASH--SQRACLGDLRD 399
                                          :||.|.|||     |...::|:  |.....|:|| 
  Fly   488 KGTFYPPVSVSEDDNSTSMRNSISALQQHCNVVTSTPSSSGGTMPTSEMSSYTVSMADNCGNLR- 551

Human   400 MISM-------YLP 406
             :||       |||
  Fly   552 -LSMNELSGNEYLP 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOX3NP_005625.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..48
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..140 19/109 (17%)
SOX-TCF_HMG-box 138..209 CDD:238684 38/70 (54%)
SOXp 208..302 CDD:289133 27/129 (21%)
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 38/70 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.