DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOX3 and mat1-Mc

DIOPT Version :10

Sequence 1:NP_005625.2 Gene:SOX3 / 6658 HGNCID:11199 Length:446 Species:Homo sapiens
Sequence 2:NP_595867.1 Gene:mat1-Mc / 2539619 PomBaseID:SPBC23G7.09 Length:181 Species:Schizosaccharomyces pombe


Alignment Length:79 Identity:25/79 - (31%)
Similarity:46/79 - (58%) Gaps:0/79 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   134 TDQDRVKRPMNAFMVWSRGQRRKMALENPKMHNSEISKRLGADWKLLTDAEKRPFIDEAKRLRAV 198
            |..:|..||.|||:::.:.:...:...||.::||::||.:|..|:..:...:..:...::..:|.
pombe    98 TSTERTPRPPNAFILYRKEKHATLLKSNPSINNSQVSKLVGEMWRNESKEVRMRYFKMSEFYKAQ 162

Human   199 HMKEYPDYKYRPRR 212
            |.|.||.|||:||:
pombe   163 HQKMYPGYKYQPRK 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOX3NP_005625.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..48
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..140 2/5 (40%)
HMG-box_SoxB 137..212 CDD:438790 23/74 (31%)
SOXp 208..302 CDD:463537 3/5 (60%)
9aaTAD. /evidence=ECO:0000269|PubMed:34342803 399..407
mat1-McNP_595867.1 HMG-box_ROX1-like 104..174 CDD:438791 21/69 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.