DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOX1 and Sox100B

DIOPT Version :9

Sequence 1:NP_005977.2 Gene:SOX1 / 6656 HGNCID:11189 Length:391 Species:Homo sapiens
Sequence 2:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster


Alignment Length:510 Identity:119/510 - (23%)
Similarity:170/510 - (33%) Gaps:234/510 - (45%)


- Green bases have known domain annotations that are detailed below.


Human    44 AKANQDR----VKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKVMSEAEKRPFIDEA 104
            |||..||    :||||||||||::..||.|:::.|.:.|||:||.||..||.:.:::|:||::.|
  Fly    66 AKAPTDRKKEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFA 130

Human   105 KRLRALHMKEHPDYKYRPRRKTKTLLKKD----------KYSLAGGLLAAG------------AG 147
            ::||..|.:|||||||:||||...:|...          :.:|:..:.::|            ||
  Fly   131 EKLRMTHKQEHPDYKYQPRRKKARVLPSQQSGEGGSPGPEMTLSATMGSSGKPRSSNSNGQRRAG 195

Human   148 GGGAAVAMG-------------------------------------------------------- 156
            .|.||..:|                                                        
  Fly   196 KGNAAADLGSCASTISHANVGSNSSDVFSNEAFMKSLNSACAASLMEQSLIETGLDSPCSTASSM 260

Human   157 --------------------------------------VGVGVGA--------AAVGQ---RLES 172
                                                  .|.|.|.        .|:|:   :.:|
  Fly   261 SSLTPPATPYNVAPSNAKASAANNPSLLLRQLSEPVANAGDGYGVLLEAGREYVAIGEVNYQGQS 325

Human   173 PG---GAAGGG-------YAHVNGWANGAYPGSVAAAAA----------AAAMMQEAQL-----A 212
            .|   ||.|||       ..::||:  |.|.||..:..|          |....|:.|.     |
  Fly   326 AGVQSGAEGGGAGQEMDFLENINGY--GGYTGSRVSYPAYSYPANGGHFATEEQQQQQALQASEA 388

Human   213 YGQHPGAGGAHP----------------HAHPAHPHP-HHPHAHPHNPQPMHRYDMGALQYSPIS 260
            ....|.|....|                |.||.|.|| |||                 |.:||..
  Fly   389 LNYKPAAADIDPKEIDQYFMDQMLPMTQHHHPHHTHPLHHP-----------------LHHSPPL 436

Human   261 NSQGYMSASPSGYGGLPYGAAAAAAAAAGGAHQNSAVAAAAAAAAASSGALGALGSLVKSEPSGS 325
            ||...:|:           |.::|::....|.....:..:.||::||            ..|:..
  Fly   437 NSSASLSS-----------ACSSASSQQPVAEYYEHLGYSPAASSAS------------QNPNFG 478

Human   326 PPAP----AHSRAPCPGDLREMISMYLPAGEGGDPAAAAAAAAQSRLHSLP-QHY 375
            |..|    |.|..|..||         ||     |.....:..|.:.|..| ||:
  Fly   479 PQQPYANGAASMTPTLGD---------PA-----PQQELQSQQQEQQHQNPSQHH 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOX1NP_005977.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 5/11 (45%)
SOX-TCF_HMG-box 50..121 CDD:238684 37/74 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..249 12/51 (24%)
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 35/69 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.