DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2bc23 and His2B:CG33868

DIOPT Version :9

Sequence 1:NP_001091448.2 Gene:H2bc23 / 665596 MGIID:3702051 Length:134 Species:Mus musculus
Sequence 2:NP_001027385.1 Gene:His2B:CG33868 / 3772265 FlyBaseID:FBgn0053868 Length:123 Species:Drosophila melanogaster


Alignment Length:128 Identity:103/128 - (80%)
Similarity:108/128 - (84%) Gaps:9/128 - (7%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MPEPAKSAPAPKKGSKKAVTKAQK---KDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGI 62
            || |..|..|.||..     ||||   |..||:||.|||||::|:||||||||||||||||||.|
  Fly     1 MP-PKTSGKAAKKAG-----KAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSI 59

Mouse    63 MNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 125
            |||||||||||||:|||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    60 MNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2bc23NP_001091448.2 Histone 3..102 CDD:278551 76/101 (75%)
H2B 12..125 CDD:304987 96/115 (83%)
His2B:CG33868NP_001027385.1 H2B 33..121 CDD:197718 82/87 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100082
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.