DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAPN15 and CalpC

DIOPT Version :9

Sequence 1:XP_011520922.1 Gene:CAPN15 / 6650 HGNCID:11182 Length:1162 Species:Homo sapiens
Sequence 2:NP_573118.2 Gene:CalpC / 32597 FlyBaseID:FBgn0260450 Length:681 Species:Drosophila melanogaster


Alignment Length:596 Identity:143/596 - (23%)
Similarity:219/596 - (36%) Gaps:176/596 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   542 WENIVAFCRENNVSFVDDSFPPGPESVGFPAGDSVQQRVRQWLRPQEI----------NCS---V 593
            :|.|::.||..||.:.|..||....||.:   ........||.|..::          |.|   |
  Fly     5 YERILSDCRSKNVLWEDPDFPAVQSSVFY---YQTPPFTFQWKRIMDLADSGSGAVAANSSAAPV 66

Human   594 FRDHRATWSVFHTLRPSDILQGLLGNCWFLSALAVLAERPDLVERVM-VTRSLC-AEGAYQVRLC 656
            |.:..|.:         |::.|.:|:.|.:|.|.:|:...:|..||: ..::|. |.|.::.||.
  Fly    67 FLNESAEF---------DVVPGKMGDRWLVSCLGLLSSLRNLFYRVVPADQTLASAHGVFRFRLW 122

Human   657 KDGTWTTVLVDDMLPCDEAGCLLFSQAQRKQ-LWVALIEKALAKLHGSYFALQAGRAIEGLATLT 720
            ..|.|..|||||.||... |.|.|.|.|... .|.||:|||:|||||||.||:.|...:||..|.
  Fly   123 WCGEWVEVLVDDRLPTIN-GRLAFMQPQASNCFWAALLEKAIAKLHGSYEALKYGTRSDGLTDLL 186

Human   721 GAPCESLALQLSSTNPR--EEPVDTDLIWAKMLSSKEA-------------GFLMGASCGGGNMK 770
            |.....:.:...:..|:  :|.:.|..| ...|:.|.|             |.|:..:       
  Fly   187 GGVVRQMPILSDNIRPQTLKELLTTTCI-VTCLADKSATVAKKNLAERMPNGILVNVN------- 243

Human   771 VDDSAYESLGLRPRHAYSILD-VRDVQG--TRLLRLRN-----PWG-RFSWNGSWSDEWPHWP-- 824
                          :..|.|| |:.:.|  .:|:.|::     |:| :..:.|.||.....|.  
  Fly   244 --------------YRLSSLDKVKTLMGDSVQLVCLKDTFSSKPFGEKTHFLGDWSPMSKTWERV 294

Human   825 -----GHLRGELMPHGSSEGVFWMEYGDFVRYFDSVDICKVHSD--------------WQEARVQ 870
                 ..|..:|.|     |.||:.:.|||..|.::::..:.::              |:....|
  Fly   295 SQVERARLIRQLGP-----GEFWLSFCDFVEIFSTMEVVYLDTETSNDEEMLKSRPLHWKMKMHQ 354

Human   871 GCFPSSASAPVGVTA----------------LTVLERASLEFALFQEGSRRSDAV--------DS 911
            |.:..      ||||                ::|.:...|..||.|..:.....:        ..
  Fly   355 GQWKR------GVTAGGCRNHESFHINPQLLISVQDEQDLVIALNQHTAVEPKVIGFTMYTWDGE 413

Human   912 HLLDLCIL--VFRATFGSGGHLSLGRLLAHSKRAVKKFVSCDVMLEPGEYAVVCCAFNHWGPPLP 974
            ::|..|:.  .|:      .|:|    ..:|.....:.||....||.|.|.::         |..
  Fly   414 YMLSECLQKDFFK------NHVS----YLNSDYGNTRHVSYHTHLEAGHYVLI---------PTT 459

Human   975 GTPAPQASSPSAGVPRASPEPPGH----VLAVYSSRLVMVEPVEAQPTTLADAIILLTESRGERH 1035
            ..||.:|                |    :|...|.||   ..:|.|...|.|....|..:..||.
  Fly   460 YEPAEEA----------------HFTVRILGTGSFRL---SCLETQTMILLDPFPALKSTDAERC 505

Human  1036 EG-REGMTCYY 1045
            .| :....|.|
  Fly   506 GGPKVKSVCQY 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAPN15XP_011520922.1 ZnF_RBZ 73..97 CDD:197784
RanBP2-type Zn finger 75..94 CDD:275376
RanBP2-type Zn finger 116..135 CDD:275376
RanBP2-type Zn finger 169..191 CDD:275375
ZnF_RBZ 213..237 CDD:197784
RanBP2-type Zn finger 215..234 CDD:275375
RanBP2-type Zn finger 412..431 CDD:275376
ZnF_RBZ 482..506 CDD:197784
RanBP2-type Zn finger 484..503 CDD:275376
CysPc 544..859 CDD:238004 99/361 (27%)
CalpCNP_573118.2 CysPc 7..329 CDD:238004 99/361 (27%)
Calpain_III 346..483 CDD:238132 33/180 (18%)
FRQ1 <567..648 CDD:227455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D704215at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.