DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAPN15 and SPAC17H9.04c

DIOPT Version :9

Sequence 1:XP_011520922.1 Gene:CAPN15 / 6650 HGNCID:11182 Length:1162 Species:Homo sapiens
Sequence 2:NP_593574.1 Gene:SPAC17H9.04c / 2542253 PomBaseID:SPAC17H9.04c Length:604 Species:Schizosaccharomyces pombe


Alignment Length:277 Identity:47/277 - (16%)
Similarity:68/277 - (24%) Gaps:105/277 - (37%)


- Green bases have known domain annotations that are detailed below.


Human    55 PRPRARSHTHSPGSMATVGEWSCVRCTFLNPAGQRQCSICE--APRH----------KPDL---- 103
            |||               |:|:|..|.|.|...:..|..|.  .|.|          .||.    
pombe   342 PRP---------------GDWNCPMCGFSNFQRRTSCFRCSFPGPTHVSAATGSNTFSPDFPYGN 391

Human   104 ---------------------NHILRLSVEEQK------------------------WPCAR--C 121
                                 .:.::..::.|.                        |.|..  |
pombe   392 SYGNGSSHFIANYGGSVHHSNENTMQSDLQHQNGNNAVNHHHSSRSFGGNVPFRAGDWKCGSEGC 456

Human   122 TFRNFLGKEACEVCG-------FTPEPAPGAAFLPVLNGVLPK------PPAILGEPKGSCQEEA 173
            .:.||.....|..||       ...:.|.|    || ||....      ||.:...|........
pombe   457 GYHNFAKNVCCLRCGASRATAAVVADHASG----PV-NGSYSHNSYSHIPPVMSTSPPNHSVYPY 516

Human   174 GPVRTAGLVATEPAR------GQCEDKDEEEKEEQEEEEGAAEPRGGWACPRCTLHNTPVASSCS 232
            ..:....:.|.....      |.....|:..:.::.........:|.|.| .|...|....|:|.
pombe   517 SQLSINSVTANHGQNFGGQNGGNVSRFDDHGRFKEVSRPSVTTDQGDWLC-ECGFTNFRRRSNCL 580

Human   233 VCGGPR--RLSLPRIPP 247
            .|..|.  .:.:|...|
pombe   581 RCNAPHYSNMQIPASLP 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAPN15XP_011520922.1 ZnF_RBZ 73..97 CDD:197784 8/25 (32%)
RanBP2-type Zn finger 75..94 CDD:275376 6/18 (33%)
RanBP2-type Zn finger 116..135 CDD:275376 6/20 (30%)
RanBP2-type Zn finger 169..191 CDD:275375 2/27 (7%)
ZnF_RBZ 213..237 CDD:197784 8/23 (35%)
RanBP2-type Zn finger 215..234 CDD:275375 6/18 (33%)
RanBP2-type Zn finger 412..431 CDD:275376
ZnF_RBZ 482..506 CDD:197784
RanBP2-type Zn finger 484..503 CDD:275376
CysPc 544..859 CDD:238004
SPAC17H9.04cNP_593574.1 RRM <233..>317 CDD:223796
RRM_ARP_like 244..326 CDD:240898
zf-RanBP 343..371 CDD:279035 10/42 (24%)
RanBP2-type Zn finger 347..366 CDD:275375 6/18 (33%)
RanBP2-type Zn finger 391..424 CDD:275375 0/32 (0%)
zf-RanBP 445..474 CDD:279035 8/28 (29%)
RanBP2-type Zn finger 449..470 CDD:275375 6/20 (30%)
RanBP2-type Zn finger 512..540 CDD:275375 2/27 (7%)
ZnF_RBZ 562..585 CDD:197784 8/23 (35%)
RanBP2-type Zn finger 564..582 CDD:275375 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.