DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOD1 and CG5948

DIOPT Version :9

Sequence 1:NP_000445.1 Gene:SOD1 / 6647 HGNCID:11179 Length:154 Species:Homo sapiens
Sequence 2:NP_651440.1 Gene:CG5948 / 43133 FlyBaseID:FBgn0039386 Length:270 Species:Drosophila melanogaster


Alignment Length:162 Identity:52/162 - (32%)
Similarity:71/162 - (43%) Gaps:33/162 - (20%)


- Green bases have known domain annotations that are detailed below.


Human     9 LKGDGP---VQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSR 70
            |.|||.   |.|:|:|.|...|..::|..::.||..|.|..|:|.|||.:.||.|.|..|     
  Fly    99 LMGDGEGAGVAGMISFVQLPYNSDIRVTINVTGLPPGKHALHIHTFGDLSDGCKSTGGQF----- 158

Human    71 KHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEE- 134
                |.:      .||||....||......:...:.|.|.:.|:||::|:|.||.||....|.| 
  Fly   159 ----PNN------FLGNVDTKDDGSISAVFQSIYLQLFGINGIVGRSIVIHSKAIDLNTALNAEV 213

Human   135 --------------STKTGNAGSRLACGVIGI 152
                          ..:..:.|..:|||||.|
  Fly   214 FSSSLQAMPNPLAYQNEENSLGPAIACGVISI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOD1NP_000445.1 Cu-Zn_Superoxide_Dismutase 3..147 CDD:238186 46/155 (30%)
CG5948NP_651440.1 Sod_Cu 108..243 CDD:278508 45/149 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1574423at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.