DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOD1 and Sod1

DIOPT Version :9

Sequence 1:NP_000445.1 Gene:SOD1 / 6647 HGNCID:11179 Length:154 Species:Homo sapiens
Sequence 2:NP_476735.1 Gene:Sod1 / 39251 FlyBaseID:FBgn0003462 Length:153 Species:Drosophila melanogaster


Alignment Length:154 Identity:94/154 - (61%)
Similarity:113/154 - (73%) Gaps:2/154 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     1 MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHF 65
            |..|||||:.||  .:|.:.|||:.|..||||.|.:.||.:||||||||||||||.||.|:||||
  Fly     1 MVVKAVCVINGD--AKGTVFFEQESSGTPVKVSGEVCGLAKGLHGFHVHEFGDNTNGCMSSGPHF 63

Human    66 NPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKG 130
            ||..::||.|.||.||:|||||:.|..|....|:|.||.|:|.|...|||||:|||..|||||:|
  Fly    64 NPYGKEHGAPVDENRHLGDLGNIEATGDCPTKVNITDSKITLFGADSIIGRTVVVHADADDLGQG 128

Human   131 GNEESTKTGNAGSRLACGVIGIAQ 154
            |:|.|..|||||:|:.|||||||:
  Fly   129 GHELSKSTGNAGARIGCGVIGIAK 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOD1NP_000445.1 Cu-Zn_Superoxide_Dismutase 3..147 CDD:238186 86/143 (60%)
Sod1NP_476735.1 Cu-Zn_Superoxide_Dismutase 2..150 CDD:412632 90/149 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142478
Domainoid 1 1.000 178 1.000 Domainoid score I3582
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H392
Inparanoid 1 1.050 194 1.000 Inparanoid score I3842
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61834
OrthoDB 1 1.010 - - D1574423at2759
OrthoFinder 1 1.000 - - FOG0000641
OrthoInspector 1 1.000 - - oto88569
orthoMCL 1 0.900 - - OOG6_101013
Panther 1 1.100 - - O PTHR10003
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1372
SonicParanoid 1 1.000 - - X1078
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.