DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOAT1 and mdy

DIOPT Version :9

Sequence 1:NP_003092.4 Gene:SOAT1 / 6646 HGNCID:11177 Length:550 Species:Homo sapiens
Sequence 2:NP_609813.1 Gene:mdy / 44887 FlyBaseID:FBgn0004797 Length:565 Species:Drosophila melanogaster


Alignment Length:599 Identity:154/599 - (25%)
Similarity:229/599 - (38%) Gaps:135/599 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    22 EDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEE--LKPFFMKEVGSHFDDFVTNLIE-- 82
            :|...:.|.|....|.::|...:.  |.|:::.:|.|.|  |.....::...:..|...|.|:  
  Fly     5 KDPQDKEPGKAEQPTKNSGSSGVG--IMKRLRRSASATEHNLSSLRNRKSTQNLFDQHGNPIDLR 67

Human    83 ---KSASLDNGGCALT----------TFSVLEGEK-NNHRAKDLRAPPEQGKIFIARRSLLDELL 133
               |....|..|....          |.||...|: :|...|..||.|.: .|...|.||.....
  Fly    68 QYRKVLDKDENGNGTNGSEKKLRYRRTQSVTRAEEISNKEEKQRRAQPGR-PIHRPRDSLFSWSS 131

Human   134 EVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFSLLSYAFGKFPTVVWTWWIMFLSTFSV 198
            ...:...:.:....||.:..|           ||.|| :||.|.....|..    |..|:|    
  Fly   132 GFTNFSGLVNWGFLLLCIGGL-----------RLGLE-NLLKYGIRINPLD----WFFFIS---- 176

Human   199 PYFLFQHWATGYSKSS--HPLIRSLFH-----------------------GFLFMIFQIGVLGFG 238
                      |:::..  :.||.|::.                       |....|..|.||...
  Fly   177 ----------GHNEGEGHNALILSIYSLVHISLCLAVEKGLAMEIIAEGLGLFIQIVNIVVLVCL 231

Human   239 PTYVV----LAYTLPPASRFIIIFEQIRFVMKAHSFVRENV----------PR------------ 277
            |...:    .|::|..||. :..|..:.| :|..|:|:.|:          ||            
  Fly   232 PVVTIHLKGHAFSLMGAST-VCFFYSVLF-LKLWSYVQTNMWCRQTYYQKNPRERRPSITLAELK 294

Human   278 --VLNSAKEK---SSTVPIP---TVNQYLYFLFAPTLIYRDSYPRNPTVRWGYVAMKFAQVFGCF 334
              |||..:|.   |..|..|   |....||||.||||.|..::||...||..::..:..:|....
  Fly   295 KGVLNGGEEDEDVSKLVQYPDNLTYKDLLYFLCAPTLCYELNFPRTSRVRKRFLLKRLLEVVIGV 359

Human   335 FYVYYIFERLCAPLFRNIKQEPFSARVLVLC---VFNSILPGVLILFLTFFAFLHCWLNAFAEML 396
            ..|..:|::...|..|| ...|||...:.|.   :....||..|.....|:...|.:|||..|:|
  Fly   360 NVVMALFQQWIIPSVRN-SLIPFSNMDVALATERLLKLALPNHLCWLCFFYLMFHSFLNAVGELL 423

Human   397 RFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYYYAYKDFLWF-FSKRFKSAAMLAVFAVSAVVH 460
            .|.||.||.||||:.:...::||||:.||.|...:.|...:.. :|.|   .|...||..|||.|
  Fly   424 NFADRNFYCDWWNANNIDTFWRTWNMPVHRWCVRHLYIPVVQMGYSSR---QASTIVFLFSAVFH 485

Human   461 EYALAVCLSFFYPVLFVLFMFFGM----AFNFIVNDSRKK---PIWNVLMWTSLFLGNGVLLCFY 518
            ||.::|.|.     ::.::.|.||    ..:.|.....||   .:.|:::|.|:.||..:.:..|
  Fly   486 EYLVSVPLQ-----IYKIWAFMGMMGQIPLSAISKSIEKKLGPRMGNIIVWASIILGQPLCIMAY 545

Human   519 SQEWYARQHCPLKN 532
            ..: |..||  .||
  Fly   546 YHD-YVVQH--FKN 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOAT1NP_003092.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39 4/16 (25%)
MBOAT 171..520 CDD:281107 112/418 (27%)
FYXDWWN motif. /evidence=ECO:0000303|PubMed:32433614 403..409 4/5 (80%)
mdyNP_609813.1 MBOAT 115..545 CDD:294479 123/471 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.