DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNTB2 and dysc

DIOPT Version :10

Sequence 1:NP_006741.1 Gene:SNTB2 / 6645 HGNCID:11169 Length:540 Species:Homo sapiens
Sequence 2:NP_001261810.1 Gene:dysc / 39533 FlyBaseID:FBgn0264006 Length:1254 Species:Drosophila melanogaster


Alignment Length:57 Identity:19/57 - (33%)
Similarity:26/57 - (45%) Gaps:9/57 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   372 VAKNSVI-----SQEKMTEI--TKNFCS--KSWEETKTSYPSVKEKYLSEYCFSGAY 419
            |..||||     :|...|:|  .|:..:  |.....|||.|:.|.|.::|.....||
  Fly   182 VPSNSVIVPEIPNQTSSTQIPLPKSVSAEVKPVASAKTSKPACKVKSVAENSAPSAY 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNTB2NP_006741.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..114
PDZ_syntrophin-like 114..196 CDD:467262
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 220..240
PHsplit_syntrophin <244..301 CDD:269960
PH 326..437 CDD:459697 19/57 (33%)
Calmodulin-binding. /evidence=ECO:0000250 518..540
dyscNP_001261810.1 PDZ_canonical 296..380 CDD:467153
PDZ2_FL-whirlin 466..546 CDD:467223
HN_L-whirlin_R2_like 573..653 CDD:259823
PDZ3_FL-whirlin-like 884..974 CDD:467224
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.