DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNX1 and SH3PX1

DIOPT Version :9

Sequence 1:NP_001229862.1 Gene:SNX1 / 6642 HGNCID:11172 Length:557 Species:Homo sapiens
Sequence 2:NP_648348.1 Gene:SH3PX1 / 39136 FlyBaseID:FBgn0040475 Length:565 Species:Drosophila melanogaster


Alignment Length:562 Identity:107/562 - (19%)
Similarity:208/562 - (37%) Gaps:126/562 - (22%)


- Green bases have known domain annotations that are detailed below.


Human     7 GCSASERLPPPF--PGL-----EPESEGAAGGSEPE-AGDSDT-----------EGEDIFTGAAV 52
            |.::..::|.||  |.|     ..:.:|:....|.: :.|:||           .|:....|.. 
  Fly    72 GATSVPQVPDPFASPPLPRYDQTADDDGSNWDDEDDWSDDNDTYSEIGPGGQKSAGQSARAGGL- 135

Human    53 VSKHQSPKITTSLLPINNGSKENGIHEEQDQEPQDLFADATVELSLDSTQNNQKKVLAKT----L 113
              .|.:.......|||           ..:.:.|.|   |:|.....:....:|.:.||:    :
  Fly   136 --SHSTSDYDNKHLPI-----------APNDDTQSL---ASVAGGTGAAGTVKKGMFAKSSDSYI 184

Human   114 ISLPPQEATNSSKPQPTYEELEEEEQ------EDQFDLTVGITDPEKIG--DGMNAYVAYKVTTQ 170
            :.|   .:|....|:.....:.:.|.      ::....:|.:..|:|..  .||..::||::|  
  Fly   185 LGL---SSTKEKIPECEMAYITQVEDSIYQWTQNHSPYSVVVASPKKESKFKGMKTFIAYQLT-- 244

Human   171 TSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFL 235
               |.|.:  .:|.||:..|..|:|:|.:|...  ..|||.|:|.:.|..:          .:|:
  Fly   245 ---PSFNN--ISVSRRYKHFDWLHERLVDKFCL--IPVPPLPDKQISGRYE----------EQFV 292

Human   236 EKRRAALERYLQRIVNHPTMLQDPDVREFLEKEELPRAVGTQTLSGAGLLKMFNKATDAVSK-MT 299
            |.||..|:.::..:..||.:.:......||...:       :.:..:|..|........|:. :.
  Fly   293 EHRRVQLQEFVDWVCRHPVISKCEVWYHFLTCRD-------EKIWKSGKRKAERDPYMGVNYCLA 350

Human   300 IKMNESDIWFEEKLQEVECEEQRLRKLHAVVETLVNHRKELALNT---------------AQFAK 349
            |...:.::...:...:||...|.:..:...|..|.|...::|..:               :..||
  Fly   351 ISPPDKNLLHSKVDAQVELGTQFIHSMDVAVRNLNNISNDMAKRSMSQSKKEFQRIGDGLSDLAK 415

Human   350 SLAM---LGSSEDNTALSRALSQLAEVEEKIEQLHQEQANNDFFLLAELLSDYIRLLAIVRAAFD 411
            :||:   ...:.:...||.::.::..:...|.|...:|..:|:..|::.|..|..:|......|.
  Fly   416 ALAIDERRAPTRNAVPLSESVGRIGGIFIGIGQAFGDQPKHDWIPLSDRLHIYRGVLNCFPDIFS 480

Human   412 QRMKTWQRWQDAQATLQKKREAEARLLWANKPDKLQQAKDEILEWESRVTQYERDFERISTVVRK 476
            ......|:.:|.:     |...|.|:   |.|               ::....|..:.:|..|..
  Fly   481 THKGAIQKRKDCE-----KLAGEGRM---NNP---------------QLHDVNRRTDVVSYTVLA 522

Human   477 EVIRFEKEKS-------KDFKNHVIKYLETLLYSQQQAGEQL 511
            |:..|:.|:.       |:|....||:.:.::...|:|..|:
  Fly   523 ELTHFKSERDTHLKHTLKNFIAEQIKFYQGVVARLQEASRQI 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNX1NP_001229862.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..84 17/95 (18%)
Sorting_nexin 55..130 CDD:281663 14/78 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..142 4/32 (13%)
PX_SNX1 145..268 CDD:132814 33/124 (27%)
Membrane-binding amphipathic helix. /evidence=ECO:0000303|PubMed:19816406 281..298 3/17 (18%)
BAR 286..506 CDD:299863 42/245 (17%)
SH3PX1NP_648348.1 SH3_SNX9_like 4..59 CDD:212697
PX_SNX9_18_like 219..343 CDD:132772 35/149 (23%)
BAR_SNX9_like 362..564 CDD:153310 41/224 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1659
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.