DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chmp4c and CG5498

DIOPT Version :10

Sequence 1:NP_079795.1 Gene:Chmp4c / 66371 MGIID:1913621 Length:232 Species:Mus musculus
Sequence 2:NP_730525.2 Gene:CG5498 / 40250 FlyBaseID:FBgn0027565 Length:448 Species:Drosophila melanogaster


Alignment Length:154 Identity:37/154 - (24%)
Similarity:70/154 - (45%) Gaps:3/154 - (1%)


- Green bases have known domain annotations that are detailed below.


Mouse    24 EALARLRETEEMLAKKQEYLENRIQRELALAKKHGSQNKRAALQALKRKKR-FEKQLTQVDGTLS 87
            :|:..|:.|:..|.|:.|.||..|:......:::..:|||...:...||:. .||...:....|.
  Fly   244 QAVHNLQNTQAQLLKQLEDLEEEIKVNDDKVRQYMKENKRQMAKTYLRKRHLLEKNHERRSLALH 308

Mouse    88 TIEFQREALENSHTNTEVLRNMGFAAKAMKAVHDNMDL--NKIDDLMQDITEQQDIAQEISEAFS 150
            .||....:::.:..:..||......:..:|.|..|..|  :.:|:::.|:.:..|..:|:.:..|
  Fly   309 NIESLLSSVDEAQNSGVVLDAYKIGSNTLKKVLSNSGLKYDNVDEVLADVRDTLDQHREVQDIMS 373

Mouse   151 QRVQFADGFDEAELLAELEELEQE 174
            ..|......::.:|..||.||..|
  Fly   374 NSVVENASQEDDQLEQELRELAGE 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chmp4cNP_079795.1 Intramolecular interaction with C-terminus. /evidence=ECO:0000250 1..153 30/131 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Snf7 24..190 CDD:460896 37/154 (24%)
Intramolecular interaction with N-terminus. /evidence=ECO:0000250 154..232 6/21 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 177..232
CG5498NP_730525.2 Snf7 244..397 CDD:460896 36/152 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.